The serving stack, network fabric, and cloud-account substrate beneath production AI, where every throughput claim collides with rebuild windows, egress invoices, and control-plane risk.https://groundy.com/en-ushttps://groundy.com/articles/running-rag-on-a-snapdragon-npu-the-on-device-retrieval-tradeoff/https://groundy.com/articles/running-rag-on-a-snapdragon-npu-the-on-device-retrieval-tradeoff/End-to-end RAG on the Snapdragon X Elite Hexagon NPU delivers 4x lower latency and 4x less energy than CPU with no quality loss, but soldered memory caps your index size.Sat, 13 Jun 2026 03:20:52 GMTGroundy Editorial2026-06-13T00:00:00.000Zragnpusnapdragon-x-eliteon-device-inferenceretrievaledge-aiGroundy Editorialhttps://groundy.com/articles/graphrag-vs-vectorrag-does-the-graph-index-earn-its-cost/https://groundy.com/articles/graphrag-vs-vectorrag-does-the-graph-index-earn-its-cost/A Samsung preprint finds vector retrieval matches GraphRAG on QA tasks at a fraction of the indexing cost, shifting the burden of proof to teams building graph pipelines.Sat, 13 Jun 2026 03:19:17 GMTGroundy Editorial2026-06-13T00:00:00.000Zraggraphragvector-searchknowledge-graphsinformation-retrievalllm-evaluationGroundy Editorialhttps://groundy.com/articles/minimax-m3-ships-1m-context-and-desktop-control-as-open-weights/https://groundy.com/articles/minimax-m3-ships-1m-context-and-desktop-control-as-open-weights/MiniMax M3 promises open weights with 1M-token context and frontier coding, but BenchLM ranks it #29 overall and #69 on multimodal. Teams need independent verification.Wed, 10 Jun 2026 05:48:38 GMTGroundy Editorial2026-06-10T00:00:00.000Zminimax-m3long-contextopen-weightssparse-attentioncode-generationmodel-benchmarksGroundy Editorialhttps://groundy.com/articles/deepseek-v4-flashmemory-sparse-attention-for-million-token-context/https://groundy.com/articles/deepseek-v4-flashmemory-sparse-attention-for-million-token-context/FlashMemory's learned index compresses DeepSeek-V4's KV cache to 13.5% of baseline at parity accuracy. The project is suspended; per-suite recall breakdowns are not published.Wed, 10 Jun 2026 01:52:16 GMTGroundy Editorial2026-06-10T00:00:00.000Zsparse-attentionkv-cachedeepseekinference-optimizationlong-contextllm-servingGroundy Editorialhttps://groundy.com/articles/is-cloudflares-bot-traffic-surge-real-the-measurement-dispute/https://groundy.com/articles/is-cloudflares-bot-traffic-surge-real-the-measurement-dispute/Cloudflare claims a 15x bot surge using a classifier that flags privacy browsers as bots. Audit your own logs before trusting the numbers behind Pay-Per-Crawl.Tue, 09 Jun 2026 14:59:26 GMTGroundy Editorial2026-06-09T00:00:00.000Zcloudflarebot-detectionai-crawlersweb-infrastructurepay-per-crawlweb-securityGroundy Editorialhttps://groundy.com/articles/huaweis-kvarn-puts-kv-cache-quantization-inside-vllms-backend/https://groundy.com/articles/huaweis-kvarn-puts-kv-cache-quantization-inside-vllms-backend/Huawei's KVarN replaces vLLM's attention backend with a 2.3-bit KV-cache quantizer claiming FP16 accuracy on reasoning. Adopters must run a Huawei-maintained fork.Tue, 09 Jun 2026 00:15:21 GMTGroundy Editorial2026-06-09T00:00:00.000Zkv-cachevllmquantizationinferencehuaweigpu-memoryGroundy Editorialhttps://groundy.com/articles/indexing-images-for-rag-kapa-ais-approach-to-multimodal-retrieval/https://groundy.com/articles/indexing-images-for-rag-kapa-ais-approach-to-multimodal-retrieval/kapa.ai's data shows indexing image captions at ingestion adds 1-6% query overhead versus 27-51% for raw query-time vision, shifting recall risk to caption fidelity.Sun, 07 Jun 2026 14:43:45 GMTGroundy Editorial2026-06-07T00:00:00.000Zragmultimodal-retrievalimage-indexingvision-modelstechnical-documentationretrieval-costGroundy Editorialhttps://groundy.com/articles/the-rtx-spark-bet-on-unified-memory-for-local-llms-where-bandwidth-caps/https://groundy.com/articles/the-rtx-spark-bet-on-unified-memory-for-local-llms-where-bandwidth-caps/LLM decode is memory-bandwidth-bound, not capacity-bound. A 70B model on 128-bit LPDDR5X hits roughly 1 tok/s. When evaluating inference hardware, count GB/s, not GB.Sat, 06 Jun 2026 21:47:28 GMTGroundy Editorial2026-06-06T00:00:00.000Zllm-inferencememory-bandwidthunified-memorylpddr5xnvidiahardware-evaluationGroundy Editorialhttps://groundy.com/articles/reading-vercels-fluid-compute-vs-cloudflare-workers-benchmark/https://groundy.com/articles/reading-vercels-fluid-compute-vs-cloudflare-workers-benchmark/Vercel benchmarks Fluid Compute 2.55x faster than Cloudflare Workers, but asymmetric configs and billing differences (CPU-ms vs GB-hour) make cost the real deciding factor.Sat, 06 Jun 2026 20:20:31 GMTGroundy Editorial2026-06-06T00:00:00.000Zserverlesscloudflare-workersvercelfluid-computebenchmarksedge-computingbilling-modelsGroundy Editorialhttps://groundy.com/articles/does-cuda-tile-match-hand-tuned-kernels-on-hopper-and-blackwell/https://groundy.com/articles/does-cuda-tile-match-hand-tuned-kernels-on-hopper-and-blackwell/CUDA Tile reaches 2.5x FlashAttention-2 on Blackwell B200 but drops to 53% on RTX PRO 6000, while Triton holds 62-101% of cuBLAS across both architectures without tuning.Sat, 06 Jun 2026 09:16:56 GMTGroundy Editorial2026-06-06T00:00:00.000Zcuda-tilegpu-kernelsblackwelltritongpu-programmingnvidiaGroundy Editorialhttps://groundy.com/articles/pod-level-remote-attestation-in-kubernetes-confidential-workloads-on-dstack/https://groundy.com/articles/pod-level-remote-attestation-in-kubernetes-confidential-workloads-on-dstack/dstack-capsule binds pod identity into Intel TDX hardware quotes, enabling multi-pod confidential VMs without the per-VM density tax of Confidential Containers.Sat, 06 Jun 2026 04:16:43 GMTGroundy Editorial2026-06-06T00:00:00.000Zconfidential-computingkubernetesremote-attestationintel-tdxconfidential-containerspod-securityGroundy Editorialhttps://groundy.com/articles/generating-gpu-kernels-for-moore-threads-silicon-can-llms-break-cuda-lock/https://groundy.com/articles/generating-gpu-kernels-for-moore-threads-silicon-can-llms-break-cuda-lock/MusaCoder trains a 9B model to emit native GPU kernels for Moore Threads' MUSA architecture, claiming parity with frontier models on vendor-controlled benchmarks.Fri, 05 Jun 2026 23:15:44 GMTGroundy Editorial2026-06-05T00:00:00.000Zgpu-kernelsmoore-threadsllm-code-generationcuda-alternativesinferencemusaGroundy Editorialhttps://groundy.com/articles/microsofts-azure-linux-goes-general-purpose-the-container-base-image-play/https://groundy.com/articles/microsofts-azure-linux-goes-general-purpose-the-container-base-image-play/Microsoft's Azure Linux 4.0 extends the internal CBL-Mariner into a Fedora-based server OS for VMs. Preview gaps remain, and AKS teams should test now but wait for GA.Fri, 05 Jun 2026 18:27:20 GMTGroundy Editorial2026-06-05T00:00:00.000Zazure-linuxkubernetessupply-chaincontainersfedoracloud-infrastructureaksGroundy Editorialhttps://groundy.com/articles/cloudflare-acquires-voidzero-the-company-behind-vites-rust-toolchain/https://groundy.com/articles/cloudflare-acquires-voidzero-the-company-behind-vites-rust-toolchain/Cloudflare acquired VoidZero, putting Vite, Rolldown, and Oxc maintainers on a deploy-target vendor's payroll. MIT licensing stays. Roadmap neutrality is the open question.Fri, 05 Jun 2026 16:08:31 GMTGroundy Editorial2026-06-05T00:00:00.000Zvitecloudflarevoidzeroopen-source-governancejavascript-toolingrolldownoxcGroundy Editorialhttps://groundy.com/articles/putting-a-datacenter-v100-in-a-gaming-pc-the-local-llm-math/https://groundy.com/articles/putting-a-datacenter-v100-in-a-gaming-pc-the-local-llm-math/A used V100 looks like cheap VRAM for local inference, but no bf16, no FlashAttention, and CUDA 13 deprecation lock buyers into a software stack that is actively contracting.Fri, 05 Jun 2026 04:10:09 GMTGroundy Editorial2026-06-05T00:00:00.000Zv100local-inferencenvidiacudagpu-hardwarevoltallm-inferenceGroundy Editorialhttps://groundy.com/articles/cost-aware-rag-routing-when-deeper-retrieval-stops-paying-off/https://groundy.com/articles/cost-aware-rag-routing-when-deeper-retrieval-stops-paying-off/CA-RAG shows fixed top-k wastes 26% of billed tokens on simple queries with no quality gain. Per-query routing changes RAG unit economics more than any embedding swap.Thu, 04 Jun 2026 01:56:08 GMTGroundy Editorial2026-06-04T00:00:00.000Zragretrieval-augmented-generationcost-optimizationquery-routingvector-searchinference-costtoken-billingGroundy Editorialhttps://groundy.com/articles/using-your-nvidia-gpus-vram-as-linux-swap-where-the-nbd-hack-breaks-down/https://groundy.com/articles/using-your-nvidia-gpus-vram-as-linux-swap-where-the-nbd-hack-breaks-down/NBD-VRAM exposes GeForce VRAM as Linux swap, but PCIe latency and the zero-sum trade with GPU compute workloads make zram the stronger choice on most systems.Wed, 03 Jun 2026 23:39:41 GMTGroundy Editorial2026-06-03T00:00:00.000Znbd-vramvram-swaplinux-swapzrammemory-managementgpu-memoryGroundy Editorialhttps://groundy.com/articles/cloudflare-turnstile-now-fingerprints-webgl-the-privacy-captcha-tradeoff/https://groundy.com/articles/cloudflare-turnstile-now-fingerprints-webgl-the-privacy-captcha-tradeoff/A researcher found Cloudflare Turnstile now demands fingerprintable WebGL to pass challenges, contradicting its privacy policy that lists only IP, TLS, and User-Agent signals.Sun, 31 May 2026 11:14:13 GMTGroundy Editorial2026-06-02T00:00:00.000Zcloudflare-turnstilewebglbrowser-fingerprintingcaptchaweb-privacybot-detectionGroundy Editorialhttps://groundy.com/articles/the-viral-aws-support-post-is-a-warning-about-cloud-escalation-paths/https://groundy.com/articles/the-viral-aws-support-post-is-a-warning-about-cloud-escalation-paths/A viral AWS support post exposed a structural pattern: hyperscalers thinning human escalation paths, raising risk for single-vendor teams reliant on reaching a person.Fri, 29 May 2026 13:16:36 GMTGroundy Editorial2026-05-29T00:00:00.000Zaws-supportcloud-escalationsingle-vendor-riskhyperscaler-automationincident-responsecloud-infrastructureGroundy Editorialhttps://groundy.com/articles/why-llms-still-botch-kubernetes-manifests-the-training-data-gap/https://groundy.com/articles/why-llms-still-botch-kubernetes-manifests-the-training-data-gap/A 1.5B-parameter model hits 91.5% on Kubernetes YAML generation, but the remaining failures are syntactically valid manifests that deploy and quietly violate cluster intent.Wed, 27 May 2026 21:20:59 GMTGroundy Editorial2026-05-28T00:00:00.000Zkubernetesllm-code-generationyamlfine-tuningdevopsplatform-engineeringGroundy Editorialhttps://groundy.com/articles/cloudflare-flagship-is-a-feature-flag-service-that-deepens-platform-gravity/https://groundy.com/articles/cloudflare-flagship-is-a-feature-flag-service-that-deepens-platform-gravity/Cloudflare's Flagship is a feature flag service with a native Workers binding that replaces third-party flag providers, consolidating more of the edge stack under one vendor.Wed, 27 May 2026 16:40:59 GMTGroundy Editorial2026-05-27T00:00:00.000Zfeature-flagscloudflare-workersedge-computingplatform-consolidationvendor-lock-inopenfeatureGroundy Editorialhttps://groundy.com/articles/gemma-4-31b-on-cloud-tpu-vs-gpu-the-serving-cost-crossover-point/https://groundy.com/articles/gemma-4-31b-on-cloud-tpu-vs-gpu-the-serving-cost-crossover-point/TPU v6e Flex-start delivers 308M tokens per dollar for Gemma 4 31B prefill, undercutting H100 rates for open-weight serving, but production decode costs remain unquantified.Wed, 27 May 2026 10:20:46 GMTGroundy Editorial2026-05-27T00:00:00.000Zinference-costgemma-4tpugpu-inferencecloud-tpuopen-weight-modelsGroundy Editorialhttps://groundy.com/articles/objectcache-moves-kv-reuse-to-s3-class-storage-why-layerwise-retrieval-beats/https://groundy.com/articles/objectcache-moves-kv-reuse-to-s3-class-storage-why-layerwise-retrieval-beats/ObjectCache retrieves KV cache per-layer from S3, adding 5.6% TTFT at 64K context but 56-75 ms at 4K. Long-context deployments where DRAM is the bottleneck benefit most.Tue, 26 May 2026 19:28:05 GMTGroundy Editorial2026-05-26T00:00:00.000Zkv-cachevllminference-optimizationobject-storagellm-servingsglangGroundy Editorialhttps://groundy.com/articles/vercels-cdn-origin-timeout-jumps-to-2-minutes-a-concession-to-llm-streaming/https://groundy.com/articles/vercels-cdn-origin-timeout-jumps-to-2-minutes-a-concession-to-llm-streaming/Vercel raised its CDN origin timeout from 30s to 120s to support LLM streaming, removing a constraint that forced teams to route AI traffic through separate infrastructure.Tue, 26 May 2026 18:08:55 GMTGroundy Editorial2026-05-26T00:00:00.000Zcdnllm-streamingvercelserverlessedge-computingsseGroundy Editorialhttps://groundy.com/articles/fluid-compute-vs-pgbouncer-vercels-undocumented-bet-on-connection-reuse/https://groundy.com/articles/fluid-compute-vs-pgbouncer-vercels-undocumented-bet-on-connection-reuse/Vercel's Fluid Compute claims to hold Postgres connections open across requests, potentially eliminating PgBouncer, but the claim lacks published technical specs.Tue, 26 May 2026 15:03:32 GMTGroundy Editorial2026-05-26T00:00:00.000Zvercel-fluid-computeconnection-poolingpostgresqlpgbouncerserverlessinfrastructureGroundy Editorialhttps://groundy.com/articles/railways-gcp-suspension-is-a-reseller-paas-problem-not-a-google-one/https://groundy.com/articles/railways-gcp-suspension-is-a-reseller-paas-problem-not-a-google-one/Railway's eight-hour outage shows why every reseller PaaS with a single upstream account is one billing flag away from total blackout, and what teams should audit now.Tue, 26 May 2026 10:49:16 GMTGroundy Editorial2026-05-26T00:00:00.000Zreseller-paascloud-infrastructureservice-discoverygcpplatform-reliabilityincident-managementGroundy Editorialhttps://groundy.com/articles/vercel-fluid-pools-database-connections-across-invocations-bypassing-external/https://groundy.com/articles/vercel-fluid-pools-database-connections-across-invocations-bypassing-external/Fluid Compute reuses Postgres connections across warm invocations via attachDatabasePool, dropping the pooler for simple apps but not for shared-database architectures.Mon, 25 May 2026 17:24:24 GMTGroundy Editorial2026-05-26T00:00:00.000Zvercel-fluidconnection-poolingpostgresserverlesspgbouncerdatabase-infrastructureGroundy Editorialhttps://groundy.com/articles/vercel-cdn-request-collapsing-one-origin-fetch-per-isr-cache-miss/https://groundy.com/articles/vercel-cdn-request-collapsing-one-origin-fetch-per-isr-cache-miss/Vercel's CDN collapses concurrent ISR cache misses into one function invocation per region, reducing origin load but leaving dynamic routes and external origins exposed.Mon, 25 May 2026 14:35:12 GMTGroundy Editorial2026-05-26T00:00:00.000Zisrvercelcdnrequest-collapsingnextjscapacity-planningedge-cachingGroundy Editorialhttps://groundy.com/articles/cisa-admin-leaked-aws-govcloud-keys-on-github-what-federal-secret-scanning/https://groundy.com/articles/cisa-admin-leaked-aws-govcloud-keys-on-github-what-federal-secret-scanning/A CISA contractor left live AWS GovCloud admin keys on a public GitHub repo for six months, exposing gaps in federal credential hygiene and FedRAMP boundary monitoring.Mon, 25 May 2026 12:34:45 GMTGroundy Editorial2026-05-26T00:00:00.000Zaws-govcloudcisacredential-leakfedrampsecret-scanninggithub-securityGroundy Editorialhttps://groundy.com/articles/what-cloudflares-q1-2026-outage-data-says-about-designing-for-state-level/https://groundy.com/articles/what-cloudflares-q1-2026-outage-data-says-about-designing-for-state-level/Three state-ordered shutdowns, drone strikes on AWS data centers, and grid collapses in Q1 2026 prove that multi-region failover cannot survive country-level failure domains.Sun, 24 May 2026 17:21:36 GMTGroundy Editorial2026-05-24T00:00:00.000Zinternet-shutdownsdisaster-recoverycloud-infrastructurecloudflarebgp-monitoringmulti-region-failoverGroundy Editorialhttps://groundy.com/articles/railways-may-19-gcp-suspension-exposes-the-single-account-risk-underneath-every/https://groundy.com/articles/railways-may-19-gcp-suspension-exposes-the-single-account-risk-underneath-every/Railway's eight-hour outage shows that multi-cloud data planes mean nothing when the control plane lives on a single provider account that can be suspended without notice.Sat, 23 May 2026 17:36:07 GMTGroundy Editorial2026-05-23T00:00:00.000Zgcprailwaycloud-outagecontrol-planepaasmulti-cloudinfrastructure-resilienceGroundy Editorialhttps://groundy.com/articles/vllm-v0-21-adds-bi-directional-kv-cache-transfers-between-prefill-and-decode/https://groundy.com/articles/vllm-v0-21-adds-bi-directional-kv-cache-transfers-between-prefill-and-decode/vLLM v0.21 reportedly adds bi-directional KV cache transfers between prefill and decode nodes, making P/D ratios dynamic and requiring new NIXL transfer telemetry.Sat, 23 May 2026 10:25:12 GMTGroundy Editorial2026-05-23T00:00:00.000Zvllmkv-cachedisaggregated-servingnixlinference-infrastructuregpu-schedulingGroundy Editorialhttps://groundy.com/articles/dmax-hits-1-338-tokens-sec-on-2x-h200-parallel-decoding-pushes-dllm-serving/https://groundy.com/articles/dmax-hits-1-338-tokens-sec-on-2x-h200-parallel-decoding-pushes-dllm-serving/DMax reformulates diffusion LLM decoding as embedding refinement, achieving 1,338 tok/s on 2× H200 and challenging ParallelBench's parallel-decoding quality trade-off finding.Tue, 19 May 2026 14:57:29 GMTGroundy Editorial2026-05-19T00:00:00.000Zdiffusion-llmparallel-decodingllm-servinginferencesglangthroughputlladaGroundy Editorialhttps://groundy.com/articles/kioxia-and-dells-10-pb-in-2ru-what-storage-density-means-for-cluster-power/https://groundy.com/articles/kioxia-and-dells-10-pb-in-2ru-what-storage-density-means-for-cluster-power/Kioxia and Dell packed 9.8 PB into a 2U server. At 245 TB per drive, rebuilds take 14-27 hours, forcing teams to retune erasure coding for production clusters.Mon, 18 May 2026 17:38:28 GMTGroundy Editorial2026-05-18T00:00:00.000Zstorage-densitynvmedata-centererasure-codingflash-storagedellssdGroundy Editorialhttps://groundy.com/articles/kv-cache-offloading-breaks-on-context-intensive-tasks-text2json-exposes/https://groundy.com/articles/kv-cache-offloading-breaks-on-context-intensive-tasks-text2json-exposes/ShadowKV-style KV cache offloading methods pass NIAH and RULER but collapse on synthesis tasks. Text2JSON quantifies the gap; YAKV's per-key selection fixes it.Mon, 18 May 2026 11:21:56 GMTGroundy Editorial2026-05-18T00:00:00.000Zkv-cacheinferencelong-contextllm-benchmarkskv-offloadingquantizationGroundy Editorialhttps://groundy.com/articles/crawshaws-i-am-building-a-cloud-what-a-tailscale-co-founders-solo-stack-implies/https://groundy.com/articles/crawshaws-i-am-building-a-cloud-what-a-tailscale-co-founders-solo-stack-implies/David Crawshaw's exe.dev launched with $35M, giving platform teams a concrete alternative to the Kubernetes default that forces TCO justification for cloud-native overhead.Wed, 29 Apr 2026 09:30:40 GMTGroundy Editorial2026-04-29T00:00:00.000Zinfrastructurekubernetescloud-costsbare-metalplatform-engineeringtailscaleexe-devGroundy Editorialhttps://groundy.com/articles/uccl-zip-brings-lossless-compression-to-nccl-collectives-475-faster-rl-weight/https://groundy.com/articles/uccl-zip-brings-lossless-compression-to-nccl-collectives-475-faster-rl-weight/UCCL-Zip fuses lossless compression into NCCL and GPU P2P transfers, cutting RL weight sync by 47.5% and vLLM latency by 10% with no API changes and bit-identical outputs.Fri, 24 Apr 2026 12:07:10 GMTGroundy Editorial2026-05-26T00:00:00.000Znccllossless-compressiongpu-communicationvllmrl-trainingprefill-decodedistributed-inferenceGroundy Editorialhttps://groundy.com/articles/ingress-nginx-is-dead-not-deprecated-the-final-cve-patches-shipped-but-platform/https://groundy.com/articles/ingress-nginx-is-dead-not-deprecated-the-final-cve-patches-shipped-but-platform/ingress-nginx was retired March 24, 2026. CVE-2026-4342 patches shipped March 19, but no future fixes are coming. How platform teams should pick a migration path.Thu, 23 Apr 2026 11:41:23 GMTGroundy Editorial2026-05-26T00:00:00.000Zkubernetesnetworkingingressgateway-apisecuritymigrationGroundy Editorialhttps://groundy.com/articles/openrag-open-source-rag-platform-challenging/https://groundy.com/articles/openrag-open-source-rag-platform-challenging/OpenRAG combines Langflow, OpenSearch, and Docling into a single deployable RAG platform. Here's how it compares to managed services like Pinecone.Fri, 27 Mar 2026 19:24:22 GMTGroundy Editorialai-infrastructureragopen-sourceGroundy Editorialhttps://groundy.com/articles/mlx-vs-llamacpp-on-apple-silicon-which-runtime-to-use-for-local-llm-inference/https://groundy.com/articles/mlx-vs-llamacpp-on-apple-silicon-which-runtime-to-use-for-local-llm-inference/MLX delivers 20-87% faster generation on Apple Silicon for models under 14B parameters. llama.cpp wins for cross-platform use and long contexts.Tue, 24 Mar 2026 16:48:05 GMTGroundy Editorial2026-06-04T00:00:00.000Zmlxllama-cppapple-siliconon-device-inferencemacoslocal-llmGroundy Editorialhttps://groundy.com/articles/prefill-decode-disaggregation-the-architecture-shift-redefining-llm-serving-at-scale/https://groundy.com/articles/prefill-decode-disaggregation-the-architecture-shift-redefining-llm-serving-at-scale/Prefill-decode disaggregation separates compute-bound prefill from memory-bound decode onto dedicated hardware, eliminating phase interference.Tue, 24 Mar 2026 16:04:14 GMTGroundy Editorial2026-06-10T00:00:00.000ZLLM servingprefilldecode disaggregationinference infrastructureMooncakeGroundy Editorialhttps://groundy.com/articles/google-litert-running-llms-your-phone-without/https://groundy.com/articles/google-litert-running-llms-your-phone-without/Google's LiteRT (formerly TensorFlow Lite) is now the production backbone for on-device GenAI across Android, Chrome, and Pixel devices. Here's what it means for developers building AI apps that run privately, without the cloud.Mon, 23 Mar 2026 09:34:21 GMTGroundy Editorial2026-05-15T00:00:00.000Zai-infrastructuremobileedge-aiGroundy Editorialhttps://groundy.com/articles/microsoft-s-bitnet-how-1-bit-llms-could-make-gpu-farms/https://groundy.com/articles/microsoft-s-bitnet-how-1-bit-llms-could-make-gpu-farms/Microsoft's BitNet inference framework runs billion-parameter LLMs on ordinary CPUs using ternary weights, delivering up to 6x faster inference and 82% lower energy consumption, potentially upending the assumption that AI inference requires expensive GPU hardware.Fri, 13 Mar 2026 17:06:56 GMTGroundy Editorialai-infrastructuremodelshardwareGroundy Editorialhttps://groundy.com/articles/webassembly-ai-running-models/https://groundy.com/articles/webassembly-ai-running-models/WebAssembly enables production-ready AI inference directly in the browser, no server required. Learn how WASM, WebGPU, and modern frameworks make client-side ML practical, what the performance trade-offs actually look like, and when to use it.Sat, 28 Feb 2026 18:18:13 GMTGroundy Editorial2026-05-18T00:00:00.000Zwebassemblybrowser-aiGroundy Editorialhttps://groundy.com/articles/tailscale-peer-relays-missing-piece-true-p2p/https://groundy.com/articles/tailscale-peer-relays-missing-piece-true-p2p/Tailscale Peer Relays became generally available on February 18, 2026, enabling high-throughput peer-to-peer relaying within your own infrastructure. This feature eliminates the performance bottleneck of DERP servers when NAT traversal fails, delivering true mesh networking even in restrictive network environments.Thu, 19 Feb 2026 19:49:47 GMTGroundy Editorial2026-05-11T00:00:00.000Znetworkingvpninfrastructurep2pGroundy Editorialhttps://groundy.com/articles/letsencrypt-dns-persist-01/https://groundy.com/articles/letsencrypt-dns-persist-01/DNS-Persist-01 proposes persistent DNS TXT records for ACME certificate validation, removing per-renewal DNS updates as certificate lifetimes shrink toward 47 days by 2029.Thu, 19 Feb 2026 18:04:22 GMTGroundy Editorial2026-05-25T00:00:00.000Zweb-platformsecurityinfrastructuressldnsGroundy Editorialhttps://groundy.com/articles/the-complete-guide-to-local-llms/https://groundy.com/articles/the-complete-guide-to-local-llms/Why running AI on your own hardware is becoming the default choice for privacy-conscious developers and enterprises that need data sovereignty, cost control, and low latency.Thu, 12 Feb 2026 18:57:59 GMTGroundy Editorial2026-06-08T00:00:00.000Zlocal-aiollamallamacppvllmprivacyself-hosted-aiGroundy Editorial