An independent publication covering developer tools, infrastructure, and the platforms shaping how software gets built.https://groundy.com/en-ushttps://groundy.com/articles/pgvector-vs-pinecone-vs-qdrant-picking-a-vector-database-in-2026/https://groundy.com/articles/pgvector-vs-pinecone-vs-qdrant-picking-a-vector-database-in-2026/pgvector, Pinecone, and Qdrant split on deployment, not on which ANN index is fastest. The call is where vectors live, who runs the cluster, and what filtered search costs.Wed, 15 Jul 2026 16:45:00 GMTGroundy Editorial2026-07-15T00:00:00.000Zpgvectorpineconeqdrantvector-databaseragpostgreshnswGroundy Editorialhttps://groundy.com/articles/can-tool-adaptive-llm-rerankers-improve-rag-without-always-calling-tools/https://groundy.com/articles/can-tool-adaptive-llm-rerankers-improve-rag-without-always-calling-tools/TALRanker folds the tool-call decision into the reranker's scoring policy, turning tool latency from a fixed per-query tax into a budget the model spends only when uncertain.Tue, 14 Jul 2026 22:48:18 GMTGroundy Editorial2026-07-14T00:00:00.000Zragrerankingtool-callingretrievalllm-inferenceinference-costGroundy Editorialhttps://groundy.com/articles/netinjectbench-prompt-injection-becomes-a-network-availability-problem/https://groundy.com/articles/netinjectbench-prompt-injection-becomes-a-network-availability-problem/An 82.5% baseline unsafe-action rate against LLM agents with network tools shifts prompt injection from a data leak to a production availability and integrity problem.Tue, 14 Jul 2026 22:15:46 GMTGroundy Editorial2026-07-14T00:00:00.000Zprompt-injectionllm-securitynetwork-operationsllm-agentsagent-securitynetinjectbenchGroundy Editorialhttps://groundy.com/articles/ollama-vs-lm-studio-picking-a-local-llm-runtime-in-2026/https://groundy.com/articles/ollama-vs-lm-studio-picking-a-local-llm-runtime-in-2026/Both wrap llama.cpp, so Ollama vs LM Studio is a headless MIT daemon versus a proprietary desktop GUI, with one ceiling: neither is a production serving engine.Tue, 14 Jul 2026 22:10:00 GMTGroundy Editorial2026-07-14T00:00:00.000Zollamalm-studiolocal-llmllama-cppmlxopen-sourceinferenceGroundy Editorialhttps://groundy.com/articles/beyond-quantization-llm-efficiency-is-now-a-memory-bandwidth-problem/https://groundy.com/articles/beyond-quantization-llm-efficiency-is-now-a-memory-bandwidth-problem/A new survey reframes LLM efficiency as a memory-bandwidth co-design problem, pushing 2027 fleet sizing toward HBM capacity over peak GPU FLOPS.Tue, 14 Jul 2026 21:51:31 GMTGroundy Editorial2026-07-14T00:00:00.000Zllm-efficiencymemory-bandwidthhbmmodel-quantizationmixture-of-expertsgpu-efficiencyattention-mechanismsGroundy Editorialhttps://groundy.com/articles/does-speculative-decoding-with-progressive-tree-drafting-cut-llm-latency/https://groundy.com/articles/does-speculative-decoding-with-progressive-tree-drafting-cut-llm-latency/Progressive Tree Drafting grows draft tokens as a pruned tree to claim a 2× speedup, but the gain hinges on verifier acceptance and shrinks on code and reasoning.Tue, 14 Jul 2026 21:32:35 GMTGroundy Editorial2026-07-14T00:00:00.000Zspeculative-decodingprogressive-tree-draftingllm-inferenceinference-latencykv-cachevllmGroundy Editorialhttps://groundy.com/articles/why-cli-coding-agents-derail-mid-run-not-at-the-first-mistake/https://groundy.com/articles/why-cli-coding-agents-derail-mid-run-not-at-the-first-mistake/CLI coding agents fail when stale early-turn assumptions compound across a trajectory, not on a single bad tool call, so per-turn metrics miss where runs actually break.Tue, 14 Jul 2026 20:52:16 GMTGroundy Editorial2026-07-14T00:00:00.000Zcoding-agentscli-agentsagent-evaluationagent-reliabilitytrajectory-managementagent-observabilityGroundy Editorialhttps://groundy.com/articles/coreweave-nebius-and-the-gpu-debt-loop-behind-your-inference-bill/https://groundy.com/articles/coreweave-nebius-and-the-gpu-debt-loop-behind-your-inference-bill/CoreWeave and Nebius finance their Nvidia fleets with hardware-collateralized debt, so the inference rate you sign embeds a credit risk premium that can move mid-contract.Tue, 14 Jul 2026 20:43:58 GMTGroundy Editorial2026-07-14T00:00:00.000Zgpu-cloudcoreweavenebiusgpu-financinginferencecredit-riskGroundy Editorialhttps://groundy.com/articles/bertopic-vs-lda-hosted-embeddings-erased-the-gpu-cost-argument/https://groundy.com/articles/bertopic-vs-lda-hosted-embeddings-erased-the-gpu-cost-argument/BERTopic's Hugging Face Hub integration pulls transformer embeddings over HTTP without a local GPU, which collapses Gensim LDA's CPU-only cost advantage for most corpuses.Tue, 14 Jul 2026 20:25:27 GMTGroundy Editorial2026-07-14T00:00:00.000Ztopic-modelingbertopicldasentence-embeddingshugging-face-hubnlpGroundy Editorialhttps://groundy.com/articles/openais-statsig-acquisition-turns-feature-flags-into-a-lock-in-question/https://groundy.com/articles/openais-statsig-acquisition-turns-feature-flags-into-a-lock-in-question/When a feature flag vendor in your critical path gets acquired by an AI platform company, a routine infrastructure choice becomes a strategic lock-in question for DevOps.Mon, 13 Jul 2026 21:43:43 GMTGroundy Editorial2026-07-13T00:00:00.000Zfeature-flagsvendor-lock-indev-toolsinfrastructure-consolidationstatsig-acquisitionexperimentation-platformsGroundy Editorialhttps://groundy.com/articles/how-sparse-llm-weights-cut-gpu-inference-cost-without-quantization/https://groundy.com/articles/how-sparse-llm-weights-cut-gpu-inference-cost-without-quantization/A three-layer sparse matmul kernel achieves 1.64x kernel-level and 1.41x end-to-end speedups, making moderate unstructured sparsity a viable third optimization lever.Mon, 13 Jul 2026 20:07:19 GMTGroundy Editorial2026-07-13T00:00:00.000Zinferencesparsitygpu-kernelsquantizationllm-optimizationarxivGroundy Editorialhttps://groundy.com/articles/type-checking-llm-agent-secrets-why-information-flow-needs-a-calculus/https://groundy.com/articles/type-checking-llm-agent-secrets-why-information-flow-needs-a-calculus/LLMbda Calculus proves agent confidentiality via labeled reduction semantics, exposing a gap between vendor sandboxing claims and verifiable information-flow control.Mon, 13 Jul 2026 19:40:06 GMTGroundy Editorial2026-07-13T00:00:00.000Zllm-agentsprompt-injectioninformation-flow-controlformal-methodsnoninterferenceagent-securitylean-proverGroundy Editorialhttps://groundy.com/articles/vercel-samlstorm-protection-misses-self-hosted-identity-providers/https://groundy.com/articles/vercel-samlstorm-protection-misses-self-hosted-identity-providers/Vercel SAMLStorm protection blocks signature-wrapping attacks at the edge, but self-hosted SAML deployments get no mitigation. Patched libraries can still authenticate forged.Mon, 13 Jul 2026 19:23:06 GMTGroundy Editorial2026-07-13T00:00:00.000Zsamlssoweb-securityauthenticationidentity-provideredge-wafvulnerability-researchGroundy Editorialhttps://groundy.com/articles/test-time-scaling-cost-falls-as-prms-reuse-generator-kv-cache/https://groundy.com/articles/test-time-scaling-cost-falls-as-prms-reuse-generator-kv-cache/KV-PRM cuts process reward model compute by reusing generator KV-caches instead of re-encoding text, reducing verification cost by up to 5,000x and making multi-agent.Mon, 13 Jul 2026 19:05:44 GMTGroundy Editorial2026-07-13T00:00:00.000Ztest-time-scalingprocess-reward-modelsmulti-agent-verificationkv-cache-optimizationinference-costmctsprmGroundy Editorialhttps://groundy.com/articles/riscboy-open-sources-a-handheld-console-designed-from-scratch/https://groundy.com/articles/riscboy-open-sources-a-handheld-console-designed-from-scratch/RISCBoy publishes complete hardware files for a handheld console with RISC-V CPU, graphics pipeline, and KiCad PCB, enabling fabrication without vendor approval.Mon, 13 Jul 2026 18:44:27 GMTGroundy Editorial2026-07-13T00:00:00.000Zrisc-vfpgaopen-hardwarehandheld-consolekicadformal-verificationright-to-repairGroundy Editorialhttps://groundy.com/articles/soofi-s-sovereign-ai-is-cheap-to-adopt-expensive-to-sustain/https://groundy.com/articles/soofi-s-sovereign-ai-is-cheap-to-adopt-expensive-to-sustain/Soofi S shows European AI sovereignty requires auditable training, not just data residency. Open weights enable compliance but the retraining burden to stay current is the.Mon, 13 Jul 2026 18:01:24 GMTGroundy Editorial2026-07-13T00:00:00.000Zopen-sourcellmsovereign-aieuropean-aimoegerman-nlpGroundy Editorialhttps://groundy.com/articles/claude-code-skills-vs-cursor-rules-vs-mcp-how-agent-skill-systems-compare/https://groundy.com/articles/claude-code-skills-vs-cursor-rules-vs-mcp-how-agent-skill-systems-compare/The July 2026 Skill Market paper defines reusable agent skills, but Claude Code, Cursor, and MCP encode skills in incompatible formats, forcing teams to pick a runtime before.Mon, 13 Jul 2026 15:53:27 GMTGroundy Editorial2026-07-13T00:00:00.000Zagent-skillsclaude-codecursormcpskill-interoperabilityagent-runtime-lock-inenterprise-auditGroundy Editorialhttps://groundy.com/articles/tthe-test-time-harness-evolution-changes-the-test-code-contract-for-coding/https://groundy.com/articles/tthe-test-time-harness-evolution-changes-the-test-code-contract-for-coding/TTHE lets a coding agent rewrite its test rig during evaluation, raising coverage but blurring spec and verification. Benchmarks must now defend why their tests stay fixed.Sun, 12 Jul 2026 12:00:14 GMTGroundy Editorial2026-07-12T00:00:00.000Zcoding-agentstest-time-adaptationharness-evolutionagent-benchmarksverificationllm-agentsGroundy Editorialhttps://groundy.com/articles/grok-build-cli-sends-file-listings-and-code-fragments-to-xai-widening-endpoint/https://groundy.com/articles/grok-build-cli-sends-file-listings-and-code-fragments-to-xai-widening-endpoint/Grok Build CLI sends file listings, editor state, and command output to xAI's cloud for inference, making that local context payload eligible under the consumer privacy.Sun, 12 Jul 2026 06:35:59 GMTGroundy Editorial2026-07-12T00:00:00.000Zgrok-buildai-agentsdata-residencyendpoint-securitytrust-boundariescli-securityGroundy Editorialhttps://groundy.com/articles/git-for-data-for-agentic-lakehouses-why-agents-need-versioned-state/https://groundy.com/articles/git-for-data-for-agentic-lakehouses-why-agents-need-versioned-state/GitLake layers git commits, branches, and merges over Apache Iceberg so agents write to reviewed branches and roll back bad outputs before they hit production tables.Sun, 12 Jul 2026 02:41:56 GMTGroundy Editorial2026-07-12T00:00:00.000Zgit-for-dataagentic-lakehouseapache-icebergdata-versioningdata-lineageagent-reliabilityGroundy Editorialhttps://groundy.com/articles/vercel-adds-zero-config-node-server-deploys-honos-pattern-goes-mainstream/https://groundy.com/articles/vercel-adds-zero-config-node-server-deploys-honos-pattern-goes-mainstream/Vercel auto-detects Express and Fastify for zero-config deploys on Fluid Compute. Static files must use public/**, express.static is ignored, and the standard cap is 250 MB.Sun, 12 Jul 2026 01:45:37 GMTGroundy Editorial2026-07-12T00:00:00.000Zvercelexpressfastifyserverlessfluid-computenode-jshonoGroundy Editorialhttps://groundy.com/articles/context-aware-prompt-injection-defenses-for-llm-agents-why-static-filters-fail/https://groundy.com/articles/context-aware-prompt-injection-defenses-for-llm-agents-why-static-filters-fail/Static filters miss prompt injection in LLM agents because a payload becomes malicious when tool outputs or retrieval chunks meet runtime state. ARGUS tracks provenance.Sat, 11 Jul 2026 21:52:02 GMTGroundy Editorial2026-07-11T00:00:00.000Zprompt-injectionllm-agentscontext-aware-defenseprovenance-auditingagent-safetymcp-securityGroundy Editorialhttps://groundy.com/articles/openais-codex-refresh-the-upgrade-that-puts-pressure-on-cursor-and-claude-code/https://groundy.com/articles/openais-codex-refresh-the-upgrade-that-puts-pressure-on-cursor-and-claude-code/OpenAI's July 2026 Codex refresh bundles a frontier agent into ChatGPT plans, challenging Cursor and Claude Code to prove value on workflow quality rather than model access.Sat, 11 Jul 2026 21:21:50 GMTGroundy Editorial2026-07-11T00:00:00.000Zopenai-codexcoding-agentscursorclaude-codeai-idedeveloper-toolsGroundy Editorialhttps://groundy.com/articles/final-token-vs-full-sequence-safety-probes-why-llm-red-teams-need-both/https://groundy.com/articles/final-token-vs-full-sequence-safety-probes-why-llm-red-teams-need-both/Final-token safety probes miss jailbreaks when unsafe evidence hides in earlier prefill tokens, so red teams should pair single-readout checks with trajectory diagnostics.Sat, 11 Jul 2026 20:53:32 GMTGroundy Editorial2026-07-11T00:00:00.000Zllm-safetyred-teamsafety-probesjailbreaksmechanistic-interpretabilityadversarial-evaluationmachine-learningGroundy Editorialhttps://groundy.com/articles/s1ngularity-supply-chain-attack-hits-nx-what-monorepo-teams-should-patch/https://groundy.com/articles/s1ngularity-supply-chain-attack-hits-nx-what-monorepo-teams-should-patch/Vercel confirmed s1ngularity compromised Nx packages. The real risk is build-time plugins: they run with CI access and can rewrite artifacts before runtime scanners see them.Sat, 11 Jul 2026 19:53:14 GMTGroundy Editorial2026-07-11T00:00:00.000Zsupply-chainnxmonorepovercelbuild-pluginsci-securitydependency-managementGroundy Editorialhttps://groundy.com/articles/game-theory-can-cut-multi-agent-llm-hallucination-but-only-if-payoffs-align/https://groundy.com/articles/game-theory-can-cut-multi-agent-llm-hallucination-but-only-if-payoffs-align/Two July 2026 preprints show game-theoretic coordination can cut LLM hallucination, yet consensus breaks if one agent prioritizes cost, latency, or engagement over agreement.Sat, 11 Jul 2026 19:15:18 GMTGroundy Editorial2026-07-11T00:00:00.000Zmulti-agentllm-hallucinationgame-theorycoordination-protocolsagent-alignmentomni-chemGroundy Editorialhttps://groundy.com/articles/webswarm-recursive-multi-agent-search-vs-flat-orchestration/https://groundy.com/articles/webswarm-recursive-multi-agent-search-vs-flat-orchestration/WebSwarm's recursive multi-agent search beats flat ReAct on deep-and-wide benchmarks. Framework builders need spawn-and-merge primitives, not just larger context windows.Sat, 11 Jul 2026 19:06:09 GMTGroundy Editorial2026-07-11T00:00:00.000Zagents-frameworksmulti-agentrecursive-searchwebswarmagent-orchestrationsearch-agentsGroundy Editorialhttps://groundy.com/articles/vercel-sandbox-hits-32-vcpu-agent-testing-escapes-laptop-limits/https://groundy.com/articles/vercel-sandbox-hits-32-vcpu-agent-testing-escapes-laptop-limits/Vercel's agentic infrastructure push lists sandboxed VMs, but the 32 vCPU tier implied by the headline is not confirmed on its public pages. Wait for specs before moving CI.Sat, 11 Jul 2026 06:47:46 GMTGroundy Editorial2026-07-11T00:00:00.000Zvercelagentic-infrastructuresandboxed-environmentsci-runnersinfrastructure-costscold-startGroundy Editorialhttps://groundy.com/articles/glm-5-2-vllm-int4-drops-mtp-without-patches-sglang-fp8-nvfp4-keeps/https://groundy.com/articles/glm-5-2-vllm-int4-drops-mtp-without-patches-sglang-fp8-nvfp4-keeps/GLM-5.2's speculative decoder speeds decode, but vLLM int4 drops MTP without a community patch. SGLang FP8/NVFP4 keeps MTP intact. Format, not kernel speed, decides serving.Sat, 11 Jul 2026 03:30:46 GMTGroundy Editorial2026-07-11T00:00:00.000Zglm-52vllmsglangspeculative-decodingquantizationinferencemtpGroundy Editorialhttps://groundy.com/articles/what-vercel-botid-catches-in-seo-poisoning-that-wafs-miss/https://groundy.com/articles/what-vercel-botid-catches-in-seo-poisoning-that-wafs-miss/Vercel BotID exposed verified Googlebots recrawling historical SEO-poisoned pages on a bank site, showing how bot identification doubles as a cloaking sensor that WAFs miss.Sat, 11 Jul 2026 02:34:30 GMTGroundy Editorial2026-07-11T00:00:00.000Zseo-poisoningbotidcloaking-detectionwaf-limitationsbot-managementthreat-intelligencerender-comparisonGroundy Editorialhttps://groundy.com/articles/how-attribution-graphs-expose-why-llm-refusal-training-misses-jailbreaks/https://groundy.com/articles/how-attribution-graphs-expose-why-llm-refusal-training-misses-jailbreaks/Attribution graphs expose LLM jailbreaks as distributed feature circuits, not a single suppressed safety direction. Circuit ablation works for open models, not closed APIs.Sat, 11 Jul 2026 00:49:33 GMTGroundy Editorial2026-07-11T00:00:00.000Zllm-jailbreaksmechanistic-interpretabilityattribution-graphssparse-autoencodersadversarial-robustnessai-safetyopen-weight-modelsGroundy Editorialhttps://groundy.com/articles/serving-deepseek-on-azure-compliance-without-owning-the-gpu-fleet/https://groundy.com/articles/serving-deepseek-on-azure-compliance-without-owning-the-gpu-fleet/DeepSeek on Azure through Vercel's AI Gateway lets regulated teams route the model inside Microsoft's perimeter, turning a binary compliance ban into a per-token cost call.Sat, 11 Jul 2026 00:23:06 GMTGroundy Editorial2026-07-11T00:00:00.000Zdeepseekazure-ai-foundryvercel-ai-gatewaydata-residencycomplianceinference-costenterprise-aiGroundy Editorialhttps://groundy.com/articles/when-ai-generates-the-slides-the-talk-stops-being-an-effort-signal/https://groundy.com/articles/when-ai-generates-the-slides-the-talk-stops-being-an-effort-signal/OmniPresent generates coherent slide decks, posters, and videos from scientific papers, so polished decks stop signaling effort and academic committees must rely on live Q&A.Sat, 11 Jul 2026 00:07:49 GMTGroundy Editorial2026-07-11T00:00:00.000Zai-presentationsscientific-communicationacademic-evaluationconference-talkseffort-signalsresearch-cultureGroundy Editorialhttps://groundy.com/articles/when-cp-sat-solvers-set-your-shifts-labor-laws-become-a-soft-constraint/https://groundy.com/articles/when-cp-sat-solvers-set-your-shifts-labor-laws-become-a-soft-constraint/CP-WSP lets labor protections such as schedule stability become weighted CP-SAT penalties, so the solver can trade away fair-scheduling rights whenever the penalty is cheap.Fri, 10 Jul 2026 22:18:07 GMTGroundy Editorial2026-07-10T00:00:00.000Zworkforce-schedulingcp-satalgorithmic-schedulingfair-workweeklabor-lawoperations-researchconstraint-programmingGroundy Editorialhttps://groundy.com/articles/analytic-inference-cuts-bayesian-deep-ensemble-serving-cost-but-leaves-training/https://groundy.com/articles/analytic-inference-cuts-bayesian-deep-ensemble-serving-cost-but-leaves-training/A new arXiv preprint replaces sampling-based averaging in Bayesian deep ensembles with closed-form Bayesian aggregation, cutting per-query inference cost and shifting the.Fri, 10 Jul 2026 22:05:25 GMTGroundy Editorial2026-07-10T00:00:00.000Zbayesian-deep-ensemblesuncertainty-quantificationanalytic-inferencebayesian-linear-regressioninference-costneural-networksarxiv-2607-06776Groundy Editorialhttps://groundy.com/articles/when-ai-counts-white-blood-cells-who-verifies-the-result/https://groundy.com/articles/when-ai-counts-white-blood-cells-who-verifies-the-result/A July 2026 preprint claims 99.04% WBC classification accuracy, but commercial systems already automate differentials. The remaining task, verifying counts, falls on senior.Fri, 10 Jul 2026 21:29:54 GMTGroundy Editorial2026-07-10T00:00:00.000Zmedical-aihematologydigital-pathologyclinical-laboratorydiagnostics-automationworkforceaccountabilityGroundy Editorialhttps://groundy.com/articles/do-coding-agents-memorize-their-benchmarks-deepswe-tests-on-unseen-tasks/https://groundy.com/articles/do-coding-agents-memorize-their-benchmarks-deepswe-tests-on-unseen-tasks/DeepSWE evaluates frontier agents on original, long-horizon tasks held out of GitHub, exposing when coding benchmarks measure memorized fixes instead of engineering skill.Fri, 10 Jul 2026 19:25:49 GMTGroundy Editorial2026-07-10T00:00:00.000Zcoding-agentsai-benchmarkssoftware-engineeringcontaminationevaluationswe-benchGroundy Editorialhttps://groundy.com/articles/tree-of-thoughts-improves-text-to-image-prompting-by-reasoning-over-hypotheses/https://groundy.com/articles/tree-of-thoughts-improves-text-to-image-prompting-by-reasoning-over-hypotheses/A new arXiv paper ports Tree-of-Thoughts prompting to text-to-image in-context learning and reports CoBSAT gains, but reasoning runs on prompt hypotheses, not image states.Fri, 10 Jul 2026 18:55:21 GMTGroundy Editorial2026-07-10T00:00:00.000Ztree-of-thoughtstext-to-imagein-context-learningprompt-engineeringcompositional-reasoningdiffusion-modelsGroundy Editorialhttps://groundy.com/articles/valve-open-sources-steam-machine-e-ink-screen-continuing-a-hardware-pattern/https://groundy.com/articles/valve-open-sources-steam-machine-e-ink-screen-continuing-a-hardware-pattern/Valve open-sourced the Steam Machine Inkterface under MIT license with CAD files, firmware, and a parts list, extending its open hardware posture, widening the moddability.Fri, 10 Jul 2026 16:48:52 GMTGroundy Editorial2026-07-10T00:00:00.000Zopen-sourcevalvesteam-machinehardware-modse-inkrepairabilitymoddabilityGroundy Editorialhttps://groundy.com/articles/buns-rust-rewrite-the-zig-creators-rebuttal/https://groundy.com/articles/buns-rust-rewrite-the-zig-creators-rebuttal/Andrew Kelley says Bun's Rust rewrite was not about Zig's features. Maintaining half a million lines in a niche language carries a hidden hiring cost.Fri, 10 Jul 2026 16:37:47 GMTGroundy Editorial2026-07-10T00:00:00.000Zbunzigrustsystems-languagescontributor-economicsmemory-safetyinfrastructureGroundy Editorialhttps://groundy.com/articles/fourierqks-spectral-q-k-filter-cuts-tinyshakespeare-loss-by-79-but-long-context/https://groundy.com/articles/fourierqks-spectral-q-k-filter-cuts-tinyshakespeare-loss-by-79-but-long-context/FourierQK filters query and key projections before attention, cutting TinyShakespeare character-level loss by 79%, but word-level, retrieval and long-context tests are absent.Fri, 10 Jul 2026 16:19:03 GMTGroundy Editorial2026-07-10T00:00:00.000Ztransformer-attentionspectral-methodslong-contextfourierqklanguage-modelsretrievalinference-costGroundy Editorialhttps://groundy.com/articles/how-llms-catch-illegal-fishing-from-records-to-enforcement/https://groundy.com/articles/how-llms-catch-illegal-fishing-from-records-to-enforcement/IUU+DB uses an LLM to turn scattered port reports and trade records into structured violation data. If precision holds, enforcement turns on document access, not headcount.Fri, 10 Jul 2026 15:16:26 GMTGroundy Editorial2026-07-10T00:00:00.000Ziuu-fishingsupply-chainllmdocument-extractionenforcementseafood-fraudlabor-abuseGroundy Editorialhttps://groundy.com/articles/claude-code-vs-antigravity-2-0-20-terminal-agent-vs-free-parallel-ide/https://groundy.com/articles/claude-code-vs-antigravity-2-0-20-terminal-agent-vs-free-parallel-ide/Antigravity 2.0 and Claude Code represent two incompatible agent architectures: a free IDE-first parallel platform versus a $20/month terminal-first sequential one.Fri, 10 Jul 2026 14:30:00 GMTGroundy Editorial2026-07-10T00:00:00.000Zclaude-codeantigravity-2coding-agentsdeveloper-toolsai-pricinggoogle-geminiagent-architectureGroundy Editorialhttps://groundy.com/articles/tencent-hunyuan-3s-agent-push-has-no-public-deepseek-or-qwen-benchmarks-yet/https://groundy.com/articles/tencent-hunyuan-3s-agent-push-has-no-public-deepseek-or-qwen-benchmarks-yet/Tencent's Hy3 is billed as a 295B agent model with a 21B active token footprint, but public materials omit benchmark tables and independent DeepSeek or Qwen comparisons.Fri, 10 Jul 2026 14:28:52 GMTGroundy Editorial2026-07-10T00:00:00.000Ztencent-hunyuanhy3mixture-of-expertsagent-modelsmodel-evaluationllm-benchmarksroutingGroundy Editorialhttps://groundy.com/articles/vercel-makes-waf-mitigated-traffic-free-recompute-your-edge-cost-model/https://groundy.com/articles/vercel-makes-waf-mitigated-traffic-free-recompute-your-edge-cost-model/Vercel now waives CDN and bandwidth charges for WAF-mitigated traffic, removing the penalty for aggressive blocking and shifting the bottleneck to rule tuning.Fri, 10 Jul 2026 13:38:20 GMTGroundy Editorial2026-07-10T00:00:00.000Zvercelwafedge-costddos-mitigationcloud-pricingsecurity-posturecost-modelGroundy Editorialhttps://groundy.com/articles/mmwave-radar-tracks-worker-posture-without-cameras-opening-a-biometric-gray-zone/https://groundy.com/articles/mmwave-radar-tracks-worker-posture-without-cameras-opening-a-biometric-gray-zone/mmWave radar research scores posture via REBA without cameras, preserving visual privacy but generating frame-rate skeletal data that may fall outside biometric consent laws.Fri, 10 Jul 2026 12:42:42 GMTGroundy Editorial2026-07-10T00:00:00.000Zmmwave-radarworker-surveillanceworkplace-privacybiometric-datareba-ergonomicslabor-lawoccupational-healthGroundy Editorialhttps://groundy.com/articles/cross-site-prompt-injection-how-web-agents-confine-untrusted-content/https://groundy.com/articles/cross-site-prompt-injection-how-web-agents-confine-untrusted-content/Prismata reframes cross-site prompt injection as an isolation problem: label page content by trust, redact untrusted text, and gate privileged tools so agents fail safe.Fri, 10 Jul 2026 12:00:14 GMTGroundy Editorial2026-07-10T00:00:00.000Zprompt-injectionweb-securitybrowser-agentsai-agentsprismataconfinementleast-privilegeGroundy Editorialhttps://groundy.com/articles/when-does-memory-not-compute-decide-who-can-profitably-serve-llms/https://groundy.com/articles/when-does-memory-not-compute-decide-who-can-profitably-serve-llms/A July 2026 arXiv paper argues that scarce HBM and DRAM bandwidth, not raw compute, will determine which labs and providers can profitably serve large language models through.Fri, 10 Jul 2026 11:38:30 GMTGroundy Editorial2026-07-10T00:00:00.000Zllm-economicshbm-scarcityinference-costsai-infrastructureopen-weightsmemory-bandwidthvintage-solvencyGroundy Editorialhttps://groundy.com/articles/can-a-4b-model-run-a-coding-agent-terminus-4b-vs-claude-and-gpt/https://groundy.com/articles/can-a-4b-model-run-a-coding-agent-terminus-4b-vs-claude-and-gpt/A 4B subagent withdrawn from arXiv claimed to match frontier models on terminal execution and cut orchestrator tokens 30%. We explain the cost angle and how to test it.Fri, 10 Jul 2026 10:39:29 GMTGroundy Editorial2026-07-10T00:00:00.000Zterminus-4bcoding-agentssubagentsmodel-routingagent-economicsterminal-executionarxiv-withdrawalGroundy Editorialhttps://groundy.com/articles/can-we-trust-llm-logic-a-graph-based-stress-test-finds-three-failure-modes/https://groundy.com/articles/can-we-trust-llm-logic-a-graph-based-stress-test-finds-three-failure-modes/A July 2026 arXiv paper shows Self-Consistency voting can hide contradictory reasoning, and GraphEVAL's graph-based coherence metrics catch flawed paths output checks miss.Fri, 10 Jul 2026 10:18:06 GMTGroundy Editorial2026-07-10T00:00:00.000Zllm-reasoninggraph-evalself-consistencychain-of-thoughtuncertainty-quantificationverificationreasoning-agentsGroundy Editorialhttps://groundy.com/articles/does-ai-belong-in-code-review-what-3100-developers-actually-argue/https://groundy.com/articles/does-ai-belong-in-code-review-what-3100-developers-actually-argue/A cs.SE preprint models 3,100 developer opinions on AI code review. The risk is not tool accuracy but teams automating defect checks while accountability and mentorship erode.Fri, 10 Jul 2026 06:35:26 GMTGroundy Editorial2026-07-10T00:00:00.000Zai-code-reviewcode-review-processsoftware-engineering-researchdeveloper-cultureai-assisted-developmentaccountabilitymentorshipGroundy Editorialhttps://groundy.com/articles/glm-5-2-hosting-compared-vercel-ai-gateway-vs-self-hosted-vllm/https://groundy.com/articles/glm-5-2-hosting-compared-vercel-ai-gateway-vs-self-hosted-vllm/GLM-5.2 self-hosting on 8 B200s costs $1.74 per million output tokens at batch 50 but $15.68 for one request. Bursty loads make a managed gateway cheaper than idle GPU node.Fri, 10 Jul 2026 06:02:13 GMTGroundy Editorial2026-07-10T00:00:00.000Zglm-52self-hostingai-gatewayinference-costsgpu-servingvllmsglangGroundy Editorialhttps://groundy.com/articles/frontier-ais-economic-exposure-is-jagged-which-economies-are-most-exposed/https://groundy.com/articles/frontier-ais-economic-exposure-is-jagged-which-economies-are-most-exposed/A new AI exposure index for 141 countries finds rich economies are far more exposed to frontier models than poor ones, so uniform retraining and subsidy policies fit badly.Fri, 10 Jul 2026 04:51:30 GMTGroundy Editorial2026-07-10T00:00:00.000Zai-exposurecross-country-economicsglobal-labor-marketsremittance-exposuregender-gappolicy-calibrationfrontier-aiGroundy Editorialhttps://groundy.com/articles/llm-burnout-is-a-labor-market-signal-not-just-a-wellness-story/https://groundy.com/articles/llm-burnout-is-a-labor-market-signal-not-just-a-wellness-story/AI coding tools speed output but hollow the craft that engages developers, producing burnout, a measurement gap, and a labor market repricing code work as supervision.Fri, 10 Jul 2026 03:55:19 GMTGroundy Editorial2026-07-11T00:00:00.000Zai-assisted-codingdeveloper-burnoutlabor-marketagentic-workflowscraft-and-automationgithub-nextGroundy Editorialhttps://groundy.com/articles/cloudflare-dmarc-management-ga-what-to-configure-before-p-reject/https://groundy.com/articles/cloudflare-dmarc-management-ga-what-to-configure-before-p-reject/Cloudflare DMARC Management is now generally available and free for Cloudflare DNS customers, but p=reject still breaks on SPF lookup limits and authentication misalignment.Fri, 10 Jul 2026 00:38:44 GMTGroundy Editorial2026-07-10T00:00:00.000Zdmarccloudflareemail-authenticationspfdeliverabilitydnsGroundy Editorialhttps://groundy.com/articles/claude-code-permissions-vs-os-privilege-isolation-what-the-gap-costs/https://groundy.com/articles/claude-code-permissions-vs-os-privilege-isolation-what-the-gap-costs/Claude Code's per-tool prompts are consent controls, not isolation. A July 2026 arXiv preprint and MCP's prompt-injection bugs show why agent runtimes need real isolation.Thu, 09 Jul 2026 23:18:41 GMTGroundy Editorial2026-07-09T00:00:00.000Zagent-securityprivilege-isolationmodel-context-protocolclaude-codeleast-privilegemcp-securityseparation-kernelGroundy Editorialhttps://groundy.com/articles/longcat-2-0-hits-claude-opus-4-6-class-on-agents-from-a-50k-gpu-cluster/https://groundy.com/articles/longcat-2-0-hits-claude-opus-4-6-class-on-agents-from-a-50k-gpu-cluster/LongCat-2.0 is a 1.6T MoE trained on a 50,000-card domestic cluster without NVIDIA silicon, posting agent scores near Claude Opus 4.6 yet CUDA serving stacks still dominate.Thu, 09 Jul 2026 20:13:00 GMTGroundy Editorial2026-07-09T00:00:00.000Zlongcat-2mixture-of-expertsagent-modelsexport-controlsnon-nvidia-traininginference-economicsGroundy Editorialhttps://groundy.com/articles/can-you-prove-a-governed-ai-agent-actually-ran-the-action-you-authorized/https://groundy.com/articles/can-you-prove-a-governed-ai-agent-actually-ran-the-action-you-authorized/A July 2026 preprint proposes Proof of Execution, a runtime attestation for every governed agent tool call. Audit receipts require instrumenting every tool invocation.Thu, 09 Jul 2026 19:45:13 GMTGroundy Editorial2026-07-09T00:00:00.000Zproof-of-executionai-agent-governanceruntime-verificationai-attestationagent-tool-callingai-auditabilitycompliance-automationGroundy Editorialhttps://groundy.com/articles/what-pre-training-a-7b-open-source-llm-actually-costs-in-energy-and-carbon/https://groundy.com/articles/what-pre-training-a-7b-open-source-llm-actually-costs-in-energy-and-carbon/Lucie 7B's life-cycle assessment on Jean Zay records 574,564 H100 GPU-hours and 21 tCO2eq, including embodied carbon. It sets a transparency benchmark for open-source LLMs.Thu, 09 Jul 2026 19:16:37 GMTGroundy Editorial2026-07-09T00:00:00.000Zopen-sourcelucie-7blife-cycle-assessmentsustainabilityai-carbon-footprintjean-zaypre-trainingGroundy Editorialhttps://groundy.com/articles/llm-memory-without-the-ram-what-ssd-backed-paging-actually-costs/https://groundy.com/articles/llm-memory-without-the-ram-what-ssd-backed-paging-actually-costs/TF-Engram pages LLM memory to SSD, moving the bottleneck from HBM to storage bandwidth, latency, and prefetch accuracy. It wins only when reads arrive before decode stalls.Thu, 09 Jul 2026 18:34:22 GMTGroundy Editorial2026-07-09T00:00:00.000Zllm-memoryssd-paginginference-optimizationstorage-bandwidthprefetchinginfrastructure-costsgpu-hbmGroundy Editorialhttps://groundy.com/articles/nvd-to-cnas-why-distributed-cve-assignment-breaks-triage/https://groundy.com/articles/nvd-to-cnas-why-distributed-cve-assignment-breaks-triage/CVEs are no longer stable units of work. Federated CNA assignment produces conflicting CVSS scores and self-divergence, pushing reconciliation to SBOM and triage pipelines.Thu, 09 Jul 2026 16:29:32 GMTGroundy Editorial2026-07-09T00:00:00.000Zcvecnacvsssbomvulnerability-triagesecurity-automationvulnerability-intelligenceGroundy Editorialhttps://groundy.com/articles/cve-to-cwe-mapping-with-bert-multi-label-vs-multi-class-error-tradeoffs/https://groundy.com/articles/cve-to-cwe-mapping-with-bert-multi-label-vs-multi-class-error-tradeoffs/A 2026 arXiv paper shows multi-class and multi-label BERT both map CVEs to CWEs, but the taxonomy, not the encoder, shapes the misclassifications that security tools inherit.Thu, 09 Jul 2026 16:00:41 GMTGroundy Editorial2026-07-09T00:00:00.000Zsecuritycvecwebertvulnerability-classificationmachine-learningtaxonomyGroundy Editorialhttps://groundy.com/articles/agenttether-repairs-llm-agent-failures-with-a-runtime-graph/https://groundy.com/articles/agenttether-repairs-llm-agent-failures-with-a-runtime-graph/AgentTether models agent runs as a directed graph, detects drift, and steers execution back without retraining. On tau-bench Banking it repaired most failures and cut tokens.Thu, 09 Jul 2026 15:20:06 GMTGroundy Editorial2026-07-09T00:00:00.000Zagent-guardrailsllm-agentsagent-orchestrationruntime-reliabilitycritical-transition-graphtau-benchagent-failuresGroundy Editorialhttps://groundy.com/articles/triton-kernels-pass-tests-but-run-slow-the-gpu-kernel-eval-gap/https://groundy.com/articles/triton-kernels-pass-tests-but-run-slow-the-gpu-kernel-eval-gap/A July 2026 preprint shows Triton and TileLang kernels can pass correctness checks yet run hundreds of times slower than library baselines, moving validation cost to adopters.Thu, 09 Jul 2026 15:06:21 GMTGroundy Editorial2026-07-09T00:00:00.000Zgpu-kernelstritontilelangtvmperformance-validationcuda-migrationkernel-benchmarkingGroundy Editorialhttps://groundy.com/articles/can-multi-agent-llm-negotiation-protocols-trust-their-own-samplers/https://groundy.com/articles/can-multi-agent-llm-negotiation-protocols-trust-their-own-samplers/Reasoning modes improve LLM negotiators as solvers but not as samplers, so multi-agent talks look inventive yet never agree; builders check moves against protocol rules.Thu, 09 Jul 2026 11:17:19 GMTGroundy Editorial2026-07-09T00:00:00.000Zmulti-agent-llmnegotiation-protocolsllm-samplingreasoning-modesagent-benchmarksprotocol-validationagent-coordinationGroundy Editorialhttps://groundy.com/articles/running-gradio-without-a-backend-how-gradio-lite-changes-ml-demos/https://groundy.com/articles/running-gradio-without-a-backend-how-gradio-lite-changes-ml-demos/Gradio-Lite runs the Gradio Python runtime in the browser through Pyodide, cutting hosting costs but shifting startup delay, download size, and memory limits to visitors.Thu, 09 Jul 2026 10:33:41 GMTGroundy Editorial2026-07-09T00:00:00.000Zgradio-litepyodidewasmclient-side-mlbrowser-inferenceml-demosgradioGroundy Editorialhttps://groundy.com/articles/vercel-edge-config-what-global-feature-flags-actually-cost-at-the-edge/https://groundy.com/articles/vercel-edge-config-what-global-feature-flags-actually-cost-at-the-edge/Vercel Edge Config reads feature flags in under 15ms, but its 10-second global write window means flipped flags can still route traffic to disabled regions.Thu, 09 Jul 2026 10:10:03 GMTGroundy Editorial2026-07-09T00:00:00.000Zedge-configvercelfeature-flagsedge-computingeventual-consistencylatencyinfrastructureGroundy Editorialhttps://groundy.com/articles/serverless-gpu-inference-on-gcp-what-the-cold-starts-actually-cost/https://groundy.com/articles/serverless-gpu-inference-on-gcp-what-the-cold-starts-actually-cost/Cloud Run GPU's 19-second cold start for Gemma 3 4B means scale-to-zero beats dedicated GPUs only for spiky, batch workloads below roughly 40 to 50 percent utilization.Thu, 09 Jul 2026 06:49:21 GMTGroundy Editorial2026-07-09T00:00:00.000Zserverless-gpucloud-runcold-startgpu-inferencegcpvertex-aiinference-costGroundy Editorialhttps://groundy.com/articles/cloudflare-oauth-for-all-what-third-party-saas-integration-at-the-edge-means/https://groundy.com/articles/cloudflare-oauth-for-all-what-third-party-saas-integration-at-the-edge-means/Cloudflare opened self-managed OAuth to all customers in June 2026, moving API authorization to the edge. Apps get delegated access, but consent records add a new lock-in.Thu, 09 Jul 2026 04:45:00 GMTGroundy Editorial2026-07-09T00:00:00.000Zcloudflare-oauthidentity-federationedge-networksaas-integrationapi-authorizationagentic-toolsoauth-migrationGroundy Editorialhttps://groundy.com/articles/vercel-in-function-concurrency-what-it-changes-for-stateful-node/https://groundy.com/articles/vercel-in-function-concurrency-what-it-changes-for-stateful-node/Vercel's in-function concurrency lets one instance run multiple Node.js or Python requests, cutting idle billing and cold starts but forcing handling of shared state, leaks.Thu, 09 Jul 2026 03:02:49 GMTGroundy Editorial2026-07-09T00:00:00.000Zvercelserverlessnodejsin-function-concurrencyfluid-computestateful-functionspaasGroundy Editorialhttps://groundy.com/articles/running-llms-on-amd-gpus-with-rocm-what-actually-works/https://groundy.com/articles/running-llms-on-amd-gpus-with-rocm-what-actually-works/HuggingFace's Optimum-AMD recipe and ROCm 7.2.4's vLLM fixes make the MI300X a serviceable inference target, but newer attention kernels and training still trail CUDA.Thu, 09 Jul 2026 01:47:16 GMTGroundy Editorial2026-07-09T00:00:00.000Zamd-gpurocmllm-inferencemi300xhuggingface-optimumvllmmodel-supportGroundy Editorialhttps://groundy.com/articles/why-your-ai-travel-agent-would-book-a-bullfight/https://groundy.com/articles/why-your-ai-travel-agent-would-book-a-bullfight/A new travel-agent benchmark finds frontier models book animal-exploitation options below chance when the welfare preference is implicit. Fix the action space, not the prompt.Thu, 09 Jul 2026 00:36:07 GMTGroundy Editorial2026-07-09T00:00:00.000Zagentsvalue-alignmentai-safetyaction-spaceguardrailstravel-agentsanimal-welfareGroundy Editorialhttps://groundy.com/articles/coding-agents-hallucinate-internal-apis-execution-memory-beats-rag-context/https://groundy.com/articles/coding-agents-hallucinate-internal-apis-execution-memory-beats-rag-context/MEMCoder's execution memory lifts private-library pass@1 by 18.41 points over RAG by learning from runtime feedback, shifting bottleneck from retrieval to sandboxed execution.Wed, 08 Jul 2026 22:56:02 GMTGroundy Editorial2026-07-08T00:00:00.000Zcoding-agentsexecution-memoryprivate-librariesragagent-memorycode-generationsandboxed-executionGroundy Editorialhttps://groundy.com/articles/metas-layoff-admission-weakens-the-case-for-ai-headcount-cuts/https://groundy.com/articles/metas-layoff-admission-weakens-the-case-for-ai-headcount-cuts/Zuckerberg said Meta's AI agent development has not accelerated as expected, weeks after 8,000 layoffs. CIOs lose their flagship case study for AI-driven headcount cuts.Wed, 08 Jul 2026 22:14:45 GMTGroundy Editorial2026-07-08T00:00:00.000Zai-headcountmetatech-layoffsenterprise-aiworkforce-restructuringcioroiGroundy Editorialhttps://groundy.com/articles/kimi-k3-confirmed-for-july-after-k2-7-lost-11-of-12-benchmark-cells/https://groundy.com/articles/kimi-k3-confirmed-for-july-after-k2-7-lost-11-of-12-benchmark-cells/Kimi K3 is expected in July 2026, a month after K2.7 Code. Monthly releases make benchmarks stale before contracts close, favoring efficiency and price over leaderboard.Wed, 08 Jul 2026 21:50:39 GMTGroundy Editorial2026-07-08T00:00:00.000Zkimi-k3moonshot-aichinese-llmbenchmark-decayapi-routinginference-efficiencymodel-cadenceGroundy Editorialhttps://groundy.com/articles/can-multi-agent-rag-run-air-gapped-a-forensics-system-shows-how/https://groundy.com/articles/can-multi-agent-rag-run-air-gapped-a-forensics-system-shows-how/CHARLIE runs multi-agent RAG on-premise for forensic evidence, removing cloud LLM calls but shifting the bottleneck to GPU capacity, structured memory, and audit logging.Wed, 08 Jul 2026 21:02:04 GMTGroundy Editorial2026-07-08T00:00:00.000Zmulti-agent-ragair-gapped-aiforensic-evidencedata-sovereigntyon-premise-llmaudit-loggingGroundy Editorialhttps://groundy.com/articles/meituan-open-sources-longcat-2-0-a-1-6t-model-trained-on-50-000-chinese-gpus/https://groundy.com/articles/meituan-open-sources-longcat-2-0-a-1-6t-model-trained-on-50-000-chinese-gpus/Meituan says LongCat-2.0 is a 1.6-trillion-parameter MoE trained on 50,000 domestic chips. If true, export controls may not confine frontier model training to national labs.Wed, 08 Jul 2026 20:06:26 GMTGroundy Editorial2026-07-08T00:00:00.000Zlongcat-2meituanmixture-of-expertsexport-controlschinese-aiopen-weightsagentic-codingGroundy Editorialhttps://groundy.com/articles/when-do-time-series-foundation-models-pay-off-the-break-even-threshold/https://groundy.com/articles/when-do-time-series-foundation-models-pay-off-the-break-even-threshold/A July 2026 arXiv break-even study finds pretrained time series foundation models win unconditionally on half of 30 datasets, but lose to ARIMA or XGBoost on a fifth at any.Wed, 08 Jul 2026 19:46:02 GMTGroundy Editorial2026-07-08T00:00:00.000Ztime-series-foundation-modelsforecastingbreak-even-analysischronosmoirailag-llamaarimaGroundy Editorialhttps://groundy.com/articles/can-you-prove-an-agentic-trading-pipeline-has-no-look-ahead-bias/https://groundy.com/articles/can-you-prove-an-agentic-trading-pipeline-has-no-look-ahead-bias/A July 2026 preprint reframes look-ahead bias as temporal non-interference, letting a type checker prove a pipeline leak-free before it runs rather than finding leaks after.Wed, 08 Jul 2026 19:31:15 GMTGroundy Editorial2026-07-08T00:00:00.000Zagentic-tradingbacktestinglook-ahead-biastemporal-non-interferenceformal-verificationtype-systemsfinancial-aiGroundy Editorialhttps://groundy.com/articles/how-far-ahead-can-a-coding-agent-plan-the-horizon-bottleneck/https://groundy.com/articles/how-far-ahead-can-a-coding-agent-plan-the-horizon-bottleneck/A July 2026 preprint says coding agents plan edits roughly 25 steps ahead before their latent program model collapses, so context length and pass@k may mismeasure failures.Wed, 08 Jul 2026 18:57:24 GMTGroundy Editorial2026-07-08T00:00:00.000Zcoding-agentslatent-horizonagent-evaluationpass-at-kcontext-windowslong-horizon-planningmechanistic-interpretabilityGroundy Editorialhttps://groundy.com/articles/cloudflare-meerkat-what-globally-distributed-consensus-costs-at-the-edge/https://groundy.com/articles/cloudflare-meerkat-what-globally-distributed-consensus-costs-at-the-edge/Cloudflare's Meerkat runs QuePaxa consensus at the edge, so every write waits on a cross-region quorum. The write-latency tax suits control-plane state, not transactions.Wed, 08 Jul 2026 18:40:07 GMTGroundy Editorial2026-07-08T00:00:00.000Zdistributed-consensuscloudflareedge-computingquepaxaglobal-distributed-systemsconsensus-latencycontrol-planeGroundy Editorialhttps://groundy.com/articles/vercel-cdn-now-honors-external-origin-cache-control-audit-your-headers/https://groundy.com/articles/vercel-cdn-now-honors-external-origin-cache-control-audit-your-headers/Since April 6, 2026, new Vercel projects honor Cache-Control from external origins by default, so operators must audit rewrite headers or risk stale, unintended responses.Wed, 08 Jul 2026 16:53:45 GMTGroundy Editorial2026-07-08T00:00:00.000Zvercelcdncache-controlexternal-originsedge-cachinghttp-cachinginfrastructureGroundy Editorialhttps://groundy.com/articles/prompt-refinement-vs-reflective-dialogue-which-builds-better-ai-coders/https://groundy.com/articles/prompt-refinement-vs-reflective-dialogue-which-builds-better-ai-coders/A July 2026 study found Socratic tutoring outperformed prompt refinement for independent LLM use among students, suggesting engineering teams may underinvest in evaluation.Wed, 08 Jul 2026 16:11:49 GMTGroundy Editorial2026-07-08T00:00:00.000Zai-educationprompt-engineeringllm-trainingenterprise-aisoftware-engineeringai-evaluationdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/ai-found-real-bugs-in-cloudflares-circl-crypto-library/https://groundy.com/articles/ai-found-real-bugs-in-cloudflares-circl-crypto-library/zkSecurity's AI agent found seven real bugs in Cloudflare's CIRCL crypto library, all fixed upstream, showing AI-assisted review is now a baseline layer for crypto code.Wed, 08 Jul 2026 15:45:43 GMTGroundy Editorial2026-07-08T00:00:00.000Zcryptographyai-security-auditcloudflarecirclvulnerability-disclosureopen-source-securitycrypto-librariesGroundy Editorialhttps://groundy.com/articles/pruning-rag-context-what-to-cut-before-the-llm-sees/https://groundy.com/articles/pruning-rag-context-what-to-cut-before-the-llm-sees/Pruning RAG context is a ranking decision. Reranking and compression keep only answer-changing chunks, shifting cost from the prompt onto retrieval and shrinking the cite set.Wed, 08 Jul 2026 15:15:22 GMTGroundy Editorial2026-07-08T00:00:00.000Zragcontext-pruningrerankingcontextual-compressionllm-inferenceretrievalcitation-faithfulnessGroundy Editorialhttps://groundy.com/articles/can-us-export-controls-contain-ai-built-without-american-chips/https://groundy.com/articles/can-us-export-controls-contain-ai-built-without-american-chips/Meituan's unverified LongCat-2.0 claim, a trillion-parameter model on domestic chips, would weaken US chip controls if true. Without proof, the bottleneck question is open.Wed, 08 Jul 2026 13:39:33 GMTGroundy Editorial2026-07-08T00:00:00.000Zexport-controlsmeituanlongcat-2-0chip-controlschina-aidomestic-acceleratorsai-policyGroundy Editorialhttps://groundy.com/articles/the-vercel-supabase-pairing-exposes-the-distribution-tax-backend-vendors-pay/https://groundy.com/articles/the-vercel-supabase-pairing-exposes-the-distribution-tax-backend-vendors-pay/The Vercel-plus-Supabase pairing exposes the platform trade for backend vendors: distribution costs margin and the customer relationship in exchange for reach.Wed, 08 Jul 2026 13:04:18 GMTGroundy Editorial2026-07-08T00:00:00.000Zsupabaseverceldeveloper-toolsplatform-economicsmarketplace-distributiongo-to-marketbackend-as-a-serviceGroundy Editorialhttps://groundy.com/articles/entropy-regularization-buys-rl-robustness-that-certification-cant-credit/https://groundy.com/articles/entropy-regularization-buys-rl-robustness-that-certification-cant-credit/A July 2026 arXiv preprint proves entropy regularization in continuous-time RL lower-bounds robustness to joint perturbations, but ISO 26262 and IEC 61508 cannot credit it.Wed, 08 Jul 2026 12:42:12 GMTGroundy Editorial2026-07-08T00:00:00.000Zreinforcement-learningentropy-regularizationrobustnessfunctional-safetycertificationai-policyGroundy Editorialhttps://groundy.com/articles/fusions-ml-disruption-predictors-have-no-shared-validation-standard/https://groundy.com/articles/fusions-ml-disruption-predictors-have-no-shared-validation-standard/A new EAST paper makes real-time tokamak disruption predictors cheap, but ML safety systems lack shared cross-machine validation standards before commercial plants debut.Wed, 08 Jul 2026 12:14:07 GMTGroundy Editorial2026-07-08T00:00:00.000Zfusion-energymachine-learningdisruption-predictiontokamaksafety-standardsgovernancecross-machine-validationGroundy Editorialhttps://groundy.com/articles/vercel-flags-segments-reach-the-cli-feature-flags-as-code-not-dashboard-clicks/https://groundy.com/articles/vercel-flags-segments-reach-the-cli-feature-flags-as-code-not-dashboard-clicks/Vercel's July 3 CLI release makes flag segments scriptable code, but segment edits propagate to all referencing flags and deletes stay blocked until dependencies clear.Wed, 08 Jul 2026 11:43:19 GMTGroundy Editorial2026-07-08T00:00:00.000Zvercel-flagsfeature-flagsclisegmentsrelease-managementinfrastructure-as-codeGroundy Editorialhttps://groundy.com/articles/openais-latest-funding-round-bets-investors-will-wait-for-a-2027-ipo/https://groundy.com/articles/openais-latest-funding-round-bets-investors-will-wait-for-a-2027-ipo/OpenAI priced its record funding round at $852 billion while delaying its IPO to 2027, forcing private backers to bet monetization can outrun compute burn before it lists.Wed, 08 Jul 2026 11:07:14 GMTGroundy Editorial2026-07-08T00:00:00.000Zopenaiai-fundingprivate-valuationipo-delaycompute-costsenterprise-aiunit-economicsGroundy Editorialhttps://groundy.com/articles/cloudflares-x402-gateway-what-per-request-api-billing-actually-needs/https://groundy.com/articles/cloudflares-x402-gateway-what-per-request-api-billing-actually-needs/Cloudflare's Monetization Gateway prices resources per request in stablecoins via HTTP 402, shifting fee friction to callers and splitting pricing into metered and flat plans.Wed, 08 Jul 2026 10:11:56 GMTGroundy Editorial2026-07-08T00:00:00.000Zx402cloudflareapi-monetizationstablecoinshttp-402micropaymentsapi-pricingGroundy Editorialhttps://groundy.com/articles/ai-generated-csam-risks-expose-filter-first-safety-gaps/https://groundy.com/articles/ai-generated-csam-risks-expose-filter-first-safety-gaps/A July 2026 ICML spotlight paper argues preventing AI-generated CSAM requires upstream design controls, because auditing, red teaming, and benchmarking cannot include it.Wed, 08 Jul 2026 08:39:41 GMTGroundy Editorial2026-07-08T00:00:00.000Zai-safetycsammodel-governanceeu-ai-actchild-protectiontraining-data-provenanceupstream-controlsGroundy Editorialhttps://groundy.com/articles/treating-ai-governance-as-code-moves-compliance-into-the-build-pipeline/https://groundy.com/articles/treating-ai-governance-as-code-moves-compliance-into-the-build-pipeline/The CANONIC preprint treats AI governance as a compiler check, lowering audit costs but confirming that structural admission cannot detect slop; it only produces an audit.Wed, 08 Jul 2026 06:06:44 GMTGroundy Editorial2026-07-08T00:00:00.000Zai-governancegovernance-as-codestructural-admissioncompliance-automationbuild-pipelineeu-ai-actpolicy-compilationGroundy Editorialhttps://groundy.com/articles/github-issues-are-now-where-gdpr-and-ccpa-compliance-gets-decided/https://groundy.com/articles/github-issues-are-now-where-gdpr-and-ccpa-compliance-gets-decided/An arXiv study of 32,820 GitHub issues finds developers negotiating GDPR and CCPA line by line, shifting privacy liability to maintainers and limiting automated scans.Wed, 08 Jul 2026 05:37:38 GMTGroundy Editorial2026-07-08T00:00:00.000Zprivacygdprccpacompliancegithubdeveloper-workflowlegal-techGroundy Editorialhttps://groundy.com/articles/composed-cli-commands-bypass-coding-agent-approval-gates-mosaic-shows/https://groundy.com/articles/composed-cli-commands-bypass-coding-agent-approval-gates-mosaic-shows/MOSAIC chains benign shell commands to bypass per-command approval in coding agents, showing yes/no gates miss cross-command risk and pushing teams toward sandboxed execution.Wed, 08 Jul 2026 05:28:17 GMTGroundy Editorial2026-07-08T00:00:00.000Zcoding-agentscli-securitycommand-compositionapproval-gatesagent-sandboxingai-securityGroundy Editorialhttps://groundy.com/articles/tencent-hunyuan-hy3-does-smaller-actually-beat-flagship-open-weights/https://groundy.com/articles/tencent-hunyuan-hy3-does-smaller-actually-beat-flagship-open-weights/Tencent's Hunyuan Hy3 is a 295B/21B-active MoE that claims to match open-weight flagships with 2-5x more parameters, a claim that would pressure the scale race if verified.Wed, 08 Jul 2026 05:10:03 GMTGroundy Editorial2026-07-08T00:00:00.000Zhunyuan-hy3mixture-of-expertschinese-llmsopen-weightsinference-efficiencymodel-benchmarksGroundy Editorialhttps://groundy.com/articles/deepseek-v4-peak-load-pricing-breaks-continuous-access-for-api-users/https://groundy.com/articles/deepseek-v4-peak-load-pricing-breaks-continuous-access-for-api-users/DeepSeek V4's peak-hour pricing forces API teams to absorb cost volatility or abandon continuous access during Beijing business hours, while self-hosted teams maintain.Wed, 08 Jul 2026 02:45:44 GMTGroundy Editorial2026-07-08T00:00:00.000Zapi-pricingdeepseek-v4peak-load-pricingself-hostingenterprise-reliabilitytime-zone-pricingGroundy Editorialhttps://groundy.com/articles/symbolic-methods-return-to-ai-as-teams-hit-diminishing-returns-on-pure-neural/https://groundy.com/articles/symbolic-methods-return-to-ai-as-teams-hit-diminishing-returns-on-pure-neural/Transformer architectures hit measurable limits on reasoning-heavy tasks, and 2025-2026 research documents a shift toward hybrid systems combining neural perception with.Wed, 08 Jul 2026 02:15:54 GMTGroundy Editorial2026-07-08T00:00:00.000Zneuro-symbolic-aiai-reasoningtransformer-architecturecode-generationtheorem-provingmulti-agent-systemsbenchmark-standardsGroundy Editorialhttps://groundy.com/articles/lara-shifts-model-safety-from-training-to-decode-time-constraints/https://groundy.com/articles/lara-shifts-model-safety-from-training-to-decode-time-constraints/LARA injects safety constraints into inference-time decoding via Lagrangian dualization, giving Best-of-N samplers formal guarantees that approach finetuning baselines while.Wed, 08 Jul 2026 01:27:19 GMTGroundy Editorial2026-07-08T00:00:00.000Zinference-time-alignmentlaraconstrained-optimizationlagrangian-dualizationbest-of-ndecode-time-safetyarxivGroundy Editorialhttps://groundy.com/articles/homegames-after-8-years-what-solo-open-source-game-infrastructure-actually/https://groundy.com/articles/homegames-after-8-years-what-solo-open-source-game-infrastructure-actually/Homegames launched after 8 years of solo development, exposing the structural gap between hobbyist pacing and sustainable infrastructure for open-source gaming platforms.Wed, 08 Jul 2026 01:07:15 GMTGroundy Editorial2026-07-08T00:00:00.000Zopen-sourcegame-developmentplatform-sustainabilityindie-gamingself-hostinggplv3Groundy Editorialhttps://groundy.com/articles/senior-swe-bench-exposes-the-gap-between-code-generation-and-software/https://groundy.com/articles/senior-swe-bench-exposes-the-gap-between-code-generation-and-software/Senior SWE-Bench shows frontier models fail over 75% of senior-level engineering tasks despite passing tests, revealing that correctness metrics don't capture architectural.Tue, 07 Jul 2026 23:36:48 GMTGroundy Editorial2026-07-07T00:00:00.000Zsenior-swe-benchcoding-agentssoftware-engineeringai-evaluationcode-reviewllm-benchmarksGroundy Editorialhttps://groundy.com/articles/symbolic-inference-forces-agent-frameworks-to-expose-intermediate-state/https://groundy.com/articles/symbolic-inference-forces-agent-frameworks-to-expose-intermediate-state/FlowFixer achieves 71.3% workflow repair through symbolic inference, enabling deterministic rollback forcing agent frameworks to expose intermediate state rather than.Tue, 07 Jul 2026 22:32:09 GMTGroundy Editorial2026-07-07T00:00:00.000Zagentic-workflowssymbolic-inferenceflowfixeragent-frameworksworkflow-debuggingdeterministic-rollbackGroundy Editorialhttps://groundy.com/articles/oomwoo-open-sources-a-repairable-robot-vacuum-splits-from-disposables/https://groundy.com/articles/oomwoo-open-sources-a-repairable-robot-vacuum-splits-from-disposables/Oomwoo launched an open-source vacuum with public schematics and firmware, making repairability structural rather than optional and challenging the Roomba sealed model.Tue, 07 Jul 2026 21:11:49 GMTGroundy Editorial2026-07-07T00:00:00.000Zopen-sourcerobot-vacuumrepairabilityros2home-assistantoffline-firsthardware-securityGroundy Editorialhttps://groundy.com/articles/e-commerce-sponsored-search-is-becoming-an-llm-relevance-problem/https://groundy.com/articles/e-commerce-sponsored-search-is-becoming-an-llm-relevance-problem/July arXiv papers show e-commerce sponsored search shifting from bid management to LLM relevance, requiring vectorized product catalogs to win ad placement auctions.Tue, 07 Jul 2026 20:37:46 GMTGroundy Editorial2026-07-07T00:00:00.000Zragvector-searchecommercellm-inferencequery-rewritinginventory-managementGroundy Editorialhttps://groundy.com/articles/ide-jailbreaks-bypass-chat-guards-by-writing-code/https://groundy.com/articles/ide-jailbreaks-bypass-chat-guards-by-writing-code/arXiv:2607.03968 shows harmful prompts succeed in IDE workflows 100% of the time despite chat refusals. The security boundary for AI coding assistants shifts from model to.Tue, 07 Jul 2026 20:19:36 GMTGroundy Editorial2026-07-07T00:00:00.000Zai-coding-agentsjailbreaksworkflow-securityide-securitychat-refusalscicd-hardeningGroundy Editorialhttps://groundy.com/articles/januscape-kvm-escape-breaks-x86-vm-isolation/https://groundy.com/articles/januscape-kvm-escape-breaks-x86-vm-isolation/Januscape (CVE-2026-53359) exposes a 16-year-old guest-to-host escape in Linux KVM that lets attackers crash hypervisor hosts from within a guest VM when nested.Tue, 07 Jul 2026 17:32:27 GMTGroundy Editorial2026-07-07T00:00:00.000Zkvmvm-escapenested-virtualizationx86linux-kernelcve-2026-53359shadow-mmuGroundy Editorialhttps://groundy.com/articles/deepseek-v4-cache-discounts-not-peak-valley-pricing-shape-cost-decisions/https://groundy.com/articles/deepseek-v4-cache-discounts-not-peak-valley-pricing-shape-cost-decisions/DeepSeek V4 has no peak-valley pricing. The real lever is a fiftyfold cache discount and hard concurrency caps that force teams to optimize for prefix reuse before July 24.Tue, 07 Jul 2026 16:25:36 GMTGroundy Editorial2026-07-07T00:00:00.000Zinferenceapi-pricingdeepseekcontext-cachingconcurrency-limitsmodel-migrationGroundy Editorialhttps://groundy.com/articles/vite-beta-mit-licensed-now-paid-tier-later/https://groundy.com/articles/vite-beta-mit-licensed-now-paid-tier-later/Vite+ beta ships as MIT-licensed open source with unified toolchain commands and enterprise templates, but VoidZero deferred commercial tier pricing until the 1.0 release.Tue, 07 Jul 2026 14:43:40 GMTGroundy Editorial2026-07-07T00:00:00.000Zvite-plusbuild-toolsrolldownjavascriptfrontend-devtoolchainweb-developmentGroundy Editorialhttps://groundy.com/articles/stochastic-dominance-reveals-where-rlhf-safety-filters-hide-tail-risk/https://groundy.com/articles/stochastic-dominance-reveals-where-rlhf-safety-filters-hide-tail-risk/Standard Safe RLHF optimizes for average harm reduction, leaving rare catastrophic outputs hidden in the tail. Stochastic dominance forces teams to bound the entire harm.Tue, 07 Jul 2026 13:33:43 GMTGroundy Editorial2026-07-07T00:00:00.000Zrlhfsafety-alignmentspectral-risk-measuresoptimal-transporttail-riskGroundy Editorialhttps://groundy.com/articles/vercels-agentic-infrastructure-push-outpaces-pricing-transparency/https://groundy.com/articles/vercels-agentic-infrastructure-push-outpaces-pricing-transparency/Vercel is building isolated execution environments for agent workloads, but without published capacity or pricing, teams cannot compare the platform against AWS Fargate or.Tue, 07 Jul 2026 12:39:34 GMTGroundy Editorial2026-07-07T00:00:00.000Zvercelagent-infrastructureserverless-alternativesagentic-workflowsdeveloper-toolscompute-pricingGroundy Editorialhttps://groundy.com/articles/box3d-launches-as-open-source-3d-physics-engine/https://groundy.com/articles/box3d-launches-as-open-source-3d-physics-engine/Box2D author Erin Catto released Box3D, a C17 open-source 3D physics engine backed by his day job at Kintsugiyama, giving game developers a credible alternative to Nvidia's.Tue, 07 Jul 2026 12:04:55 GMTGroundy Editorial2026-07-07T00:00:00.000Zopen-sourcephysics-enginegame-developmentc-languagecross-platformrigid-bodiescollision-detectionGroundy Editorialhttps://groundy.com/articles/vla-grounder-tests-language-conditioning-to-optimize-black-box-vision-action/https://groundy.com/articles/vla-grounder-tests-language-conditioning-to-optimize-black-box-vision-action/VLA Grounder shows frozen vision-language-action models improve when language is an optimizable input. Success rates increased from 12.6% to 38.7% for pi0 and 24.4% to 63.9%.Tue, 07 Jul 2026 08:32:18 GMTGroundy Editorial2026-07-07T00:00:00.000Zvlaroboticsgroundinglanguage-conditioningblack-box-optimizationmultimodal-modelsrlGroundy Editorialhttps://groundy.com/articles/cursor-ios-privacy-migration-shows-why-mobile-ides-cant-be-audited/https://groundy.com/articles/cursor-ios-privacy-migration-shows-why-mobile-ides-cant-be-audited/Cursor's iOS app migrated users to a new privacy mode without consent, exposing how iOS sandbox design prevents developers from auditing or reversing what mobile IDEs do with.Tue, 07 Jul 2026 02:19:09 GMTGroundy Editorial2026-07-07T00:00:00.000Zmobile-idesios-sandbox-securitycursor-iosdeveloper-tool-privacycode-exposure-riskGroundy Editorialhttps://groundy.com/articles/black-box-llm-architecture-inference-what-api-restrictions-reveal-about-hidden/https://groundy.com/articles/black-box-llm-architecture-inference-what-api-restrictions-reveal-about-hidden/NightVision recovers transformer hidden dimension to within 23% error using only single logprob output and timing, proving API restrictions meant to protect model IP instead.Tue, 07 Jul 2026 01:46:01 GMTGroundy Editorial2026-07-07T00:00:00.000Zllm-securityblack-box-attacksapi-restrictionsmodel-inferencetiming-side-channelsnightvision-attackGroundy Editorialhttps://groundy.com/articles/inducekv-tests-continual-learning-for-multimodal-llms-without-expanding-cache/https://groundy.com/articles/inducekv-tests-continual-learning-for-multimodal-llms-without-expanding-cache/InduceKV keeps multimodal LLM adaptation under a fixed KV memory budget, outperforming replay and PEFT while trading selection complexity for serving simplicity.Tue, 07 Jul 2026 00:49:07 GMTGroundy Editorial2026-07-07T00:00:00.000Zmultimodal-llmscontinual-learningkv-cachememory-managementadaptation-methodsinference-optimizationGroundy Editorialhttps://groundy.com/articles/unit-labor-costs-hit-post-war-high-as-productivity-decouples-from-wages/https://groundy.com/articles/unit-labor-costs-hit-post-war-high-as-productivity-decouples-from-wages/Q1 2026 BLS data shows unit labor costs at 123.78, a post-1947 high, while productivity grew just 0.3% and hourly compensation rose 2.1%. The gap reveals how productivity.Tue, 07 Jul 2026 00:04:39 GMTGroundy Editorial2026-07-07T00:00:00.000Zlabor-economicsproductivitywage-stagnationunit-labor-costsincome-distributionbls-dataeconomic-inequalityGroundy Editorialhttps://groundy.com/articles/june-2026-labor-force-contraction-tests-structural-detachment-thesis/https://groundy.com/articles/june-2026-labor-force-contraction-tests-structural-detachment-thesis/June 2026 BLS data shows 720,000 workers exited the labor force while participation held at 61.5 percent, raising questions about whether policy should shift from stimulus to.Mon, 06 Jul 2026 23:43:22 GMTGroundy Editorial2026-07-06T00:00:00.000Zlabor-force-participationeconomic-policyemployment-datastructural-unemploymentjobs-reportbls-datarecession-signalsGroundy Editorialhttps://groundy.com/articles/tab-completion-hides-a-vigilance-drop-that-copilot-metrics-miss/https://groundy.com/articles/tab-completion-hides-a-vigilance-drop-that-copilot-metrics-miss/High tab-acceptance tracks with worse attention checks per June 2026 ITiCSE data. Copilot dashboards celebrating accept rate miss the vigilance drop requiring peer review.Mon, 06 Jul 2026 23:32:39 GMTGroundy Editorial2026-07-06T00:00:00.000Zai-code-completioncopilotcursordeveloper-productivitypeer-reviewiticse-2026Groundy Editorialhttps://groundy.com/articles/junes-jobs-polarization-reveals-ai-era-skills-repricing/https://groundy.com/articles/junes-jobs-polarization-reveals-ai-era-skills-repricing/June's 4.2% unemployment rate masks deeper movement: sectoral polarization between professional and service work points to skill repricing, even as headline data supplies no.Mon, 06 Jul 2026 23:20:25 GMTGroundy Editorial2026-07-06T00:00:00.000Zlabor-force-participationunemployment-rateskill-repricingai-era-workforcebls-jobs-reportsectoral-polarizationwage-dataGroundy Editorialhttps://groundy.com/articles/boundary-sync-why-multi-agent-representational-coupling-is-the-new-coordination/https://groundy.com/articles/boundary-sync-why-multi-agent-representational-coupling-is-the-new-coordination/BOUNDARY_SYNC introduces the Coupling Amplification Factor to measure how inter-agent communication homogenizes multi-agent LLM systems, eroding diversity benefits.Mon, 06 Jul 2026 20:03:49 GMTGroundy Editorial2026-07-06T00:00:00.000Zmulti-agent-systemsllm-agentsrepresentational-couplingcoordination-protocolscaf-metricagent-diversityGroundy Editorialhttps://groundy.com/articles/kimi-k2-7-code-lands-in-github-copilot-what-the-integration-excludes/https://groundy.com/articles/kimi-k2-7-code-lands-in-github-copilot-what-the-integration-excludes/GitHub Copilot's first open-weight model, Kimi K2.7, trades deterministic output and CI/CD compatibility for 256K context and tokens roughly five times cheaper than GPT-5.5.Mon, 06 Jul 2026 18:35:30 GMTGroundy Editorial2026-07-06T00:00:00.000Zgithub-copilotkimi-k27open-weight-modelsllm-cicdmoonshot-aimodel-selectionGroundy Editorialhttps://groundy.com/articles/sonnet-5-vs-gpt-5-5-pricing-benchmarks-and-the-switching-math/https://groundy.com/articles/sonnet-5-vs-gpt-5-5-pricing-benchmarks-and-the-switching-math/Sonnet 5 undercuts GPT-5.5 by 60% on input tokens and leads coding benchmarks, but a new tokenizer inflates effective costs and Anthropic did not publish GPQA scores.Fri, 03 Jul 2026 14:30:00 GMTGroundy Editorial2026-07-03T00:00:00.000Zclaude-sonnet-5gpt-5-5ai-pricingmodel-comparisonanthropicopenaillm-benchmarksGroundy Editorialhttps://groundy.com/articles/do-multi-agent-rag-systems-write-better-readmes-than-one-agent/https://groundy.com/articles/do-multi-agent-rag-systems-write-better-readmes-than-one-agent/An ICSME 2026 study finds single-agent RAG matches multi-agent README quality using 86% fewer tokens and half the latency, while developer-guided planning beats both.Tue, 30 Jun 2026 06:57:56 GMTGroundy Editorial2026-06-30T00:00:00.000Zragmulti-agent-systemsdocumentation-generationagent-orchestrationllm-evaluationsoftware-engineeringGroundy Editorialhttps://groundy.com/articles/jailbreaks-hidden-in-image-pixels-slip-past-editors-text-guardrails-via/https://groundy.com/articles/jailbreaks-hidden-in-image-pixels-slip-past-editors-text-guardrails-via/VJA embeds jailbreak instructions in image pixels with an empty text prompt, leaving text-only guardrails nothing to scan and forcing moderation into the pixel pipeline.Tue, 30 Jun 2026 05:39:39 GMTGroundy Editorial2026-06-30T00:00:00.000Zjailbreakprompt-injectionimage-editingmultimodalcontent-moderationtrust-and-safetyvision-modelsGroundy Editorialhttps://groundy.com/articles/doubao-2-1-pro-what-180-trillion-daily-tokens-means-for-inference-infrastructure/https://groundy.com/articles/doubao-2-1-pro-what-180-trillion-daily-tokens-means-for-inference-infrastructure/Doubao 2.1 Pro ships at ¥6/¥30 per million tokens. The family's 180 trillion daily tokens reset what Western inference stacks must assume about price and capacity.Tue, 30 Jun 2026 04:58:29 GMTGroundy Editorial2026-06-30T00:00:00.000Zinference-infrastructurellm-pricingdoubaotoken-economicsapi-routinggpu-capacityGroundy Editorialhttps://groundy.com/articles/vercel-firewall-in-the-cli-whats-still-missing/https://groundy.com/articles/vercel-firewall-in-the-cli-whats-still-missing/Vercel Firewall now has a CLI, but the dashboard is still required. We map the controls that stay manual, the vercel.json action subset, and per-region rate-limit trap.Tue, 30 Jun 2026 02:24:55 GMTGroundy Editorial2026-06-30T00:00:00.000Zvercel-firewallvercel-cliterraformwafsecuritydevopsedgeGroundy Editorialhttps://groundy.com/articles/every-cuda-kernel-pays-a-launch-tax-the-host-to-device-walkthrough/https://groundy.com/articles/every-cuda-kernel-pays-a-launch-tax-the-host-to-device-walkthrough/Every CUDA kernel pays a fixed driver-queue tax before its first FLOP runs. The fusion, graphs, and batching sold as bandwidth wins mostly hide the launch overhead.Tue, 30 Jun 2026 01:10:39 GMTGroundy Editorial2026-06-30T00:00:00.000Zcudagpukernel-launchinference-optimizationcuda-graphslatencyGroundy Editorialhttps://groundy.com/articles/how-llms-fuse-conflicting-facts-single-source-vs-multi-source-truth/https://groundy.com/articles/how-llms-fuse-conflicting-facts-single-source-vs-multi-source-truth/LLMs beat classic truth-discovery on conflicting facts, but the same reasoning treats repeated low-credibility claims as corroboration. More sources do not mean more truth.Tue, 30 Jun 2026 00:53:15 GMTGroundy Editorial2026-06-30T00:00:00.000Zdata-fusiontruth-discoveryknowledge-conflictsragllm-factualitysource-credibilityGroundy Editorialhttps://groundy.com/articles/linux-foundation-akrites-centralizes-open-source-vulnerability-disclosure/https://groundy.com/articles/linux-foundation-akrites-centralizes-open-source-vulnerability-disclosure/Akrites pools 19 vendors behind one shared vulnerability disclosure SIRT to absorb a flood of duplicate LLM reports, but risks becoming the new bottleneck itself.Mon, 29 Jun 2026 23:53:17 GMTGroundy Editorial2026-06-29T00:00:00.000Zvulnerability-disclosureopen-source-securitysoftware-supply-chainlinux-foundationsecurity-incident-responsevulnerability-managementGroundy Editorialhttps://groundy.com/articles/linear-transformers-get-a-learnable-kernel-does-flexformer-change/https://groundy.com/articles/linear-transformers-get-a-learnable-kernel-does-flexformer-change/Flexformer makes linear attention's kernel learnable by training spectral frequencies, but the abstract offers no perplexity or accuracy numbers to back its gains.Mon, 29 Jun 2026 23:00:54 GMTGroundy Editorial2026-06-29T00:00:00.000Zlinear-attentiontransformersefficient-attentionattention-mechanismsequence-modelingmachine-learningGroundy Editorialhttps://groundy.com/articles/why-llm-prompt-injection-persists-instructions-and-data-share-embeddings/https://groundy.com/articles/why-llm-prompt-injection-persists-instructions-and-data-share-embeddings/A 2026 preprint argues prompt injection is mathematically unpreventable when instructions and data share one embedding space, making defenses cost-raisers rather than cures.Mon, 29 Jun 2026 22:08:39 GMTGroundy Editorial2026-06-29T00:00:00.000Zprompt-injectionllm-securityai-securityllm-embeddingsadversarial-attacksai-safetyGroundy Editorialhttps://groundy.com/articles/generative-ai-moves-the-freelance-bottleneck-from-tasks-to-skill-repricing/https://groundy.com/articles/generative-ai-moves-the-freelance-bottleneck-from-tasks-to-skill-repricing/Generative AI already saturates a third of organizations, but the freelance-labor data is thin. The real shift moves the bottleneck from task automation to skill repricing.Mon, 29 Jun 2026 21:05:29 GMTGroundy Editorial2026-06-29T00:00:00.000Zgenerative-aifreelance-economyonline-labor-marketsskill-repricingai-adoptionpreprintsGroundy Editorialhttps://groundy.com/articles/uncertainty-aware-reward-discounting-cuts-reward-hacking-93-6-in-a-preprint/https://groundy.com/articles/uncertainty-aware-reward-discounting-cuts-reward-hacking-93-6-in-a-preprint/A three-day-old preprint cuts reward hacking 93.6% by down-weighting uncertain reward signals, but the result is unreplicated and may shift RLHF red-teaming if it holds.Mon, 29 Jun 2026 20:26:23 GMTGroundy Editorial2026-06-29T00:00:00.000Zreward-hackingreinforcement-learningrlhfai-safetyreward-modelinguncertainty-quantificationai-alignmentGroundy Editorialhttps://groundy.com/articles/when-bots-and-agents-post-cves-in-prs-reporters-inherit-the-triage-burden/https://groundy.com/articles/when-bots-and-agents-post-cves-in-prs-reporters-inherit-the-triage-burden/When a bot or agent drops a CVE into a pull request, the thread reads as already triaged. Reviewers move on, and the reporter inherits the job of proving it real.Mon, 29 Jun 2026 19:35:44 GMTGroundy Editorial2026-06-29T00:00:00.000Zvulnerability-triagepull-requestssecurity-botscoding-agentsdependabotfalse-positivescode-reviewGroundy Editorialhttps://groundy.com/articles/runtime-vs-build-time-sboms-why-your-container-runs-uncatalogued-code/https://groundy.com/articles/runtime-vs-build-time-sboms-why-your-container-runs-uncatalogued-code/Build-time SBOMs miss the code Python actually runs. The MEM-SBOM preprint shows memory forensics recovers dynamically loaded packages static manifests never recorded.Mon, 29 Jun 2026 18:12:21 GMTGroundy Editorial2026-06-29T00:00:00.000Zsbomsupply-chain-securitymemory-forensicspythonvulnerability-managementeu-craGroundy Editorialhttps://groundy.com/articles/elkj-ps-next-js-move-shows-vercel-wants-retail-operations-not-just-websites/https://groundy.com/articles/elkj-ps-next-js-move-shows-vercel-wants-retail-operations-not-just-websites/Elkjøp's Next.js move puts Vercel inside its ecommerce release loop, turning a frontend host into an operational dependency that outages and price hikes hit at checkout.Mon, 29 Jun 2026 17:49:47 GMTGroundy Editorial2026-06-29T00:00:00.000Zvercelnext-jsecommercevendor-lock-incore-web-vitalsedge-computingGroundy Editorialhttps://groundy.com/articles/agentic-ai-turns-location-trails-into-a-re-identification-tool/https://groundy.com/articles/agentic-ai-turns-location-trails-into-a-re-identification-tool/A June 2026 arXiv preprint shows LLM agents re-identify people from anonymized location traces with no human analyst, naming 18 of 25 targets. Re-audit mobility datasets.Mon, 29 Jun 2026 16:57:42 GMTGroundy Editorial2026-06-29T00:00:00.000Zagentic-ailocation-privacyre-identificationdata-anonymizationgdprmobility-dataGroundy Editorialhttps://groundy.com/articles/huawei-ships-cuda-free-ai-compute-on-device-but-ascend-quantization-accuracy/https://groundy.com/articles/huawei-ships-cuda-free-ai-compute-on-device-but-ascend-quantization-accuracy/Huawei ships CUDA-free AI compute on domestic silicon today, but specific OpenPangu quantization accuracy claims on Ascend NPUs lack any readable primary source.Mon, 29 Jun 2026 16:22:04 GMTGroundy Editorial2026-06-29T00:00:00.000Zhuawei-ascendquantizationllm-inferencechinese-aion-device-aidomestic-siliconpanguGroundy Editorialhttps://groundy.com/articles/vercel-montreal-region-audit-residency-before-you-migrate/https://groundy.com/articles/vercel-montreal-region-audit-residency-before-you-migrate/A Vercel Montreal region only earns its cost when a legal rule forces data to stay in Canada. For every other workload, the real work is a residency audit, not a migration.Mon, 29 Jun 2026 15:49:34 GMTGroundy Editorial2026-06-29T00:00:00.000Zdata-residencyverceledge-computingserverlesscloud-infrastructurecomplianceGroundy Editorialhttps://groundy.com/articles/how-a-human-agent-team-lifts-one-video-into-4d-interactions/https://groundy.com/articles/how-a-human-agent-team-lifts-one-video-into-4d-interactions/HAT-4D pairs a VLM agent with a human to lift one monocular video into 4D multi-object interactions, shifting embodied-AI data costs from capture rigs to feedback design.Mon, 29 Jun 2026 15:29:55 GMTGroundy Editorial2026-06-29T00:00:00.000Z4d-reconstructionhuman-in-the-loopembodied-aivision-language-modelsmonocular-videomulti-object-interactionGroundy Editorialhttps://groundy.com/articles/safetensors-vs-pickle-why-hugging-face-chose-it-after-the-security-audit/https://groundy.com/articles/safetensors-vs-pickle-why-hugging-face-chose-it-after-the-security-audit/A Trail of Bits audit cleared Safetensors as the Hub's default weights format, closing the load-time code execution vector that pickle-based PyTorch checkpoints carry.Mon, 29 Jun 2026 14:05:14 GMTGroundy Editorial2026-06-29T00:00:00.000Zsafetensorspicklemodel-securityhugging-facepytorchsupply-chain-securityGroundy Editorialhttps://groundy.com/articles/do-multimodal-rag-models-ignore-late-evidence-a-primacy-bias-test/https://groundy.com/articles/do-multimodal-rag-models-ignore-late-evidence-a-primacy-bias-test/Multimodal RAG readers lose 16 to 26 percentage points when the correct evidence sits at the end of context, and standard rerankers do not close the gap.Mon, 29 Jun 2026 12:54:18 GMTGroundy Editorial2026-06-29T00:00:00.000Zmultimodal-ragragvision-language-modelsposition-biasrerankingvisual-question-answeringGroundy Editorialhttps://groundy.com/articles/openais-agent-link-safety-isolates-the-fetch-not-prompt-injection/https://groundy.com/articles/openais-agent-link-safety-isolates-the-fetch-not-prompt-injection/OpenAI's link-safety control stops quiet URL-based exfiltration by agents, not prompt injection. The trust boundary is moving from model output to network policy.Mon, 29 Jun 2026 11:53:27 GMTGroundy Editorial2026-06-29T00:00:00.000Zagent-securityprompt-injectiondata-exfiltrationopenaisession-isolationthreat-modelingGroundy Editorialhttps://groundy.com/articles/can-llm-agents-learn-cooperation-laws-from-embodied-play/https://groundy.com/articles/can-llm-agents-learn-cooperation-laws-from-embodied-play/LLawCo turns embodied agents' cooperation failures into readable rules fine-tuned into reasoning, making coordination policy an inspectable artifact engineers can edit.Mon, 29 Jun 2026 11:33:24 GMTGroundy Editorial2026-06-29T00:00:00.000Zmulti-agent-llmsembodied-agentsagent-coordinationsupervised-finetuningagent-reliabilitycooperation-lawsGroundy Editorialhttps://groundy.com/articles/no-verified-react2shell-bulletin-exists-what-next-js-teams-should-check/https://groundy.com/articles/no-verified-react2shell-bulletin-exists-what-next-js-teams-should-check/A 'React2Shell' Vercel security bulletin is circulating, but no primary advisory, CVE, or technical write-up could be located as of 2026-06-29. Here is how to verify.Mon, 29 Jun 2026 11:09:21 GMTGroundy Editorial2026-07-10T00:00:00.000Zreact2shellnextjsvercelreact-server-componentssecurity-advisoryshell-injectionGroundy Editorialhttps://groundy.com/articles/can-deep-learning-design-rf-power-amplifiers-without-full-em-simulation/https://groundy.com/articles/can-deep-learning-design-rf-power-amplifiers-without-full-em-simulation/A Chalmers/Tampere paper trains a CNN on EM-simulated layouts to search Doherty amplifier combiners in milliseconds. EM simulation is amortized, not eliminated.Mon, 29 Jun 2026 10:46:18 GMTGroundy Editorial2026-06-29T00:00:00.000Zrf-power-amplifiersdeep-learninginverse-designem-simulationdoherty-amplifiermachine-learningsurrogate-modelGroundy Editorialhttps://groundy.com/articles/vercel-on-the-axios-npm-compromise-platform-scanning-has-a-blind-spot/https://groundy.com/articles/vercel-on-the-axios-npm-compromise-platform-scanning-has-a-blind-spot/Vercel's Axios changelog exposes where platform defenses stop: post-publication egress blocks leave the install-time window on dev laptops and CI runners uncovered.Mon, 29 Jun 2026 10:10:08 GMTGroundy Editorial2026-06-29T00:00:00.000Znpm-supply-chainsupply-chain-securityaxiosvercelnpmsapphire-sleetmalwareGroundy Editorialhttps://groundy.com/articles/govern-the-repo-not-the-agent-a-new-risk-metric-for-ai-native-code/https://groundy.com/articles/govern-the-repo-not-the-agent-a-new-risk-metric-for-ai-native-code/A study of 930,000 agent-authored pull requests finds AI-native risk accumulates at the repository, not the agent, pushing governance to CI/CD and platform teams.Mon, 29 Jun 2026 09:53:43 GMTGroundy Editorial2026-06-29T00:00:00.000Zai-coding-agentsrepository-governancesoftware-supply-chainci-cdcode-reviewagent-safetyGroundy Editorialhttps://groundy.com/articles/llm-generated-verifast-specs-shift-the-trust-bottleneck-from-proofs-to-review/https://groundy.com/articles/llm-generated-verifast-specs-shift-the-trust-bottleneck-from-proofs-to-review/An arXiv preprint tests LLM-generated VeriFast specs. The real danger is a silently accepted wrong contract, because verifiers treat any accepted spec as gospel.Mon, 29 Jun 2026 08:30:32 GMTGroundy Editorial2026-07-10T00:00:00.000Zformal-verificationllm-generated-specsverifastseparation-logicspecification-reviewproof-engineeringprogram-correctnessGroundy Editorialhttps://groundy.com/articles/glm-5-2-on-vllm-and-ascend-open-weights-beyond-nvidia/https://groundy.com/articles/glm-5-2-on-vllm-and-ascend-open-weights-beyond-nvidia/GLM-5.2 ships MIT-licensed with same-week serving recipes for NVIDIA vLLM and Huawei Ascend NPUs, breaking the open-weights-but-NVIDIA-only trade-off for self-hosters.Mon, 29 Jun 2026 05:27:31 GMTGroundy Editorial2026-06-29T00:00:00.000Zglm-5-2vllmascendinferenceself-hostingopen-weightsGroundy Editorialhttps://groundy.com/articles/hugging-face-is-absorbing-computer-vision-into-vision-language-models/https://groundy.com/articles/hugging-face-is-absorbing-computer-vision-into-vision-language-models/Computer vision is consolidating onto vision-language models on Hugging Face's Hub, so practitioners must prove each checkpoint does what its Model Card claims.Mon, 29 Jun 2026 04:32:48 GMTGroundy Editorial2026-06-29T00:00:00.000Zhugging-facecomputer-visionvision-language-modelsmodel-hubreproducibilitymodel-cardsGroundy Editorialhttps://groundy.com/articles/can-an-ai-agent-catch-cryptographic-misuse-before-it-ships-chai-tests-the-claim/https://groundy.com/articles/can-an-ai-agent-catch-cryptographic-misuse-before-it-ships-chai-tests-the-claim/The Chai preprint reframes cryptographic misuse as a protocol-context recognition problem, claiming an LLM agent found a critical SSL-library flaw and 100-plus crypto bugs.Sun, 28 Jun 2026 23:56:48 GMTGroundy Editorial2026-06-28T00:00:00.000Zcryptographic-misusesastai-agentsvulnerability-discoveryapplication-securityllm-securityGroundy Editorialhttps://groundy.com/articles/vercels-cli-is-a-deployment-path-not-a-control-plane/https://groundy.com/articles/vercels-cli-is-a-deployment-path-not-a-control-plane/Vercel's CLI is a deployment path, not a complete control plane. The April 2026 env-var breach and the push to agent operators make its lifecycle gaps impossible to ignore.Sun, 28 Jun 2026 23:24:21 GMTGroundy Editorial2026-07-11T00:00:00.000Zvercel-clienvironment-variablesplatform-engineeringinfrastructure-as-codedeployment-automationdevsecopsGroundy Editorialhttps://groundy.com/articles/how-vercel-runs-its-own-cdn-in-front-of-discourse-a-self-dogfooding-case-study/https://groundy.com/articles/how-vercel-runs-its-own-cdn-in-front-of-discourse-a-self-dogfooding-case-study/Vercel fronts its own Discourse forum with its CDN, but the edge cache only serves anonymous reads. Logged-in pages fall to the origin by design.Sun, 28 Jun 2026 22:36:04 GMTGroundy Editorial2026-06-28T00:00:00.000Zedge-cachingcdnverceldiscoursereverse-proxymicrofrontendsGroundy Editorialhttps://groundy.com/articles/bytedances-doubao-seed-2-1-pro-production-grade-claims-vendor-graded-evidence/https://groundy.com/articles/bytedances-doubao-seed-2-1-pro-production-grade-claims-vendor-graded-evidence/ByteDance pitches Doubao Seed 2.1 Pro as production-grade AI at 6 CNY per million tokens, but scores are vendor-graded and Doubao is absent from independent leaderboards.Sun, 28 Jun 2026 21:21:54 GMTGroundy Editorial2026-06-28T00:00:00.000Zdoubaobytedancechinese-llmsllm-benchmarksmaasenterprise-aiGroundy Editorialhttps://groundy.com/articles/glm-5-2-goes-open-weights-what-the-long-horizon-coding-pitch-leaves-out/https://groundy.com/articles/glm-5-2-goes-open-weights-what-the-long-horizon-coding-pitch-leaves-out/GLM-5.2 ships under MIT with real Coding Plan pricing, but the 1M context is opt-in, its coding benchmarks are vendor-reported, and Cursor integration is undocumented.Sun, 28 Jun 2026 20:57:41 GMTGroundy Editorial2026-06-28T00:00:00.000Zglm-52open-weightscoding-agentsllm-benchmarksai-inference-costz-aiGroundy Editorialhttps://groundy.com/articles/medical-ai-liability-needs-a-clinical-harness/https://groundy.com/articles/medical-ai-liability-needs-a-clinical-harness/A June 2026 preprint reframes medical AI governance around runtime-governed clinical skills, exposing who is liable when diagnosis, scheduling, and documentation chain fails.Sun, 28 Jun 2026 20:18:11 GMTGroundy Editorial2026-06-28T00:00:00.000Zmedical-aiai-governanceai-liabilityclinical-aisoftware-as-medical-deviceai-regulationGroundy Editorialhttps://groundy.com/articles/synthetic-clinical-notes-from-llms-believable-prose-is-not-clinical-validity/https://groundy.com/articles/synthetic-clinical-notes-from-llms-believable-prose-is-not-clinical-validity/A 70-patient synthetic EHR pipeline shows believable prose is not clinical validity. Fabricated dosages and labs poison models and invite HIPAA and FDA scrutiny.Sun, 28 Jun 2026 19:56:27 GMTGroundy Editorial2026-06-28T00:00:00.000Zsynthetic-dataclinical-aillm-hallucinationehrhipaadata-validationGroundy Editorialhttps://groundy.com/articles/doubao-vs-qwen-3-7-vs-glm-5-2-route-by-axis-not-leaderboard/https://groundy.com/articles/doubao-vs-qwen-3-7-vs-glm-5-2-route-by-axis-not-leaderboard/Doubao-Seed-2.1 Pro's parity claims are vendor-graded and unreproduced. Route the Chinese flagship tier by axis: Qwen for ZH to EN, Doubao for EN to ZH, DeepSeek for code.Sun, 28 Jun 2026 19:36:03 GMTGroundy Editorial2026-06-28T00:00:00.000Zchinese-llmsmodel-routingllm-benchmarksdoubaoqwenzhipu-glmGroundy Editorialhttps://groundy.com/articles/vercel-runtime-logs-surface-cdn-cache-hits-not-the-eviction-cause/https://groundy.com/articles/vercel-runtime-logs-surface-cdn-cache-hits-not-the-eviction-cause/Vercel's Runtime Logs now show CDN cache key, tags, and revalidation reason per request, but the eviction cause stays hidden, forcing manual header inspection.Sun, 28 Jun 2026 18:07:19 GMTGroundy Editorial2026-06-28T00:00:00.000Zvercelcdn-cacheruntime-logscache-telemetryobservabilityedge-cachingGroundy Editorialhttps://groundy.com/articles/can-dynamic-experts-fix-catastrophic-forgetting-in-robot-manipulation/https://groundy.com/articles/can-dynamic-experts-fix-catastrophic-forgetting-in-robot-manipulation/LiMoDE freezes a pre-trained expert bank and adds low-rank experts per new task, forcing continual robot learning to choose between architecture and replay.Sun, 28 Jun 2026 17:32:20 GMTGroundy Editorial2026-06-28T00:00:00.000Zcontinual-learningmixture-of-expertsrobot-manipulationcatastrophic-forgettingmoe-routinglora-adaptersGroundy Editorialhttps://groundy.com/articles/huggingface-personal-copilot-the-bottleneck-is-your-codebase-not-compute/https://groundy.com/articles/huggingface-personal-copilot-the-bottleneck-is-your-codebase-not-compute/Personal Copilot fine-tunes StarCoder on your file contents, not your commit history. The bottleneck is whether your code is clean enough to teach what Copilot does not know.Sun, 28 Jun 2026 16:27:59 GMTGroundy Editorial2026-06-28T00:00:00.000Zfine-tuningpersonal-copilotcode-completiondata-curationstarcoderpeftGroundy Editorialhttps://groundy.com/articles/llama-4-on-vercels-ai-model-gateway-hosted-inference-vs-self-hosted-vllm/https://groundy.com/articles/llama-4-on-vercels-ai-model-gateway-hosted-inference-vs-self-hosted-vllm/Vercel's AI Model Gateway promises zero-ops Llama 4 inference for Next.js apps but lists no models or rates. Self-hosting the 17B-active MoE keeps the knobs Vercel hides.Sun, 28 Jun 2026 15:33:33 GMTGroundy Editorial2026-06-28T00:00:00.000Zllama-4vercelinferencevllmself-hostingmixture-of-expertsserverlessGroundy Editorialhttps://groundy.com/articles/vercels-pre-generate-ssl-flow-stages-certs-before-dns-cutover/https://groundy.com/articles/vercels-pre-generate-ssl-flow-stages-certs-before-dns-cutover/Vercel stages a Let's Encrypt cert via DNS-01 TXT records while traffic serves elsewhere, so HTTPS is valid at DNS cutover, though wildcards need Vercel nameservers.Sun, 28 Jun 2026 15:06:46 GMTGroundy Editorial2026-06-28T00:00:00.000Zvercelssl-certificatesdns-01acmedomain-migrationlets-encryptGroundy Editorialhttps://groundy.com/articles/error-conditioned-neural-solvers-vs-iterative-refinement-when-does-learned/https://groundy.com/articles/error-conditioned-neural-solvers-vs-iterative-refinement-when-does-learned/A June 2026 preprint feeds the PDE residual into a neural corrector as input, not an optimization target, shifting surrogate cost from inference loops to training capacity.Sun, 28 Jun 2026 12:35:16 GMTGroundy Editorial2026-06-28T00:00:00.000Zneural-solverspdescientific-machine-learningsurrogate-modelsnumerical-methodsiterative-refinementGroundy Editorialhttps://groundy.com/articles/vision-language-models-move-past-object-detection-the-mllm-perception-shift/https://groundy.com/articles/vision-language-models-move-past-object-detection-the-mllm-perception-shift/Vision-language models now reason over tables, charts, and documents, but detection-era benchmarks still rank them on box localization and undercount comprehension.Sun, 28 Jun 2026 10:23:34 GMTGroundy Editorial2026-06-28T00:00:00.000Zvision-language-modelsmultimodal-llmsmllm-benchmarksobject-detectionvisual-reasoningdocument-intelligencetable-understandingGroundy Editorialhttps://groundy.com/articles/can-autoregressive-boltzmann-generators-replace-mcmc-in-simulation/https://groundy.com/articles/can-autoregressive-boltzmann-generators-replace-mcmc-in-simulation/ArBG reframes equilibrium sampling as one forward pass and beats flow-based generators, but MD training data and importance-sampling reweighting remain in the pipeline.Sun, 28 Jun 2026 09:40:13 GMTGroundy Editorial2026-06-28T00:00:00.000Zboltzmann-generatorsmolecular-simulationautoregressive-modelsnormalizing-flowsmcmccomputational-chemistrydrug-discoveryGroundy Editorialhttps://groundy.com/articles/multimodal-knowledge-graph-rag-vs-vector-rag-what-mkg-rag-bench-shows/https://groundy.com/articles/multimodal-knowledge-graph-rag-vs-vector-rag-what-mkg-rag-bench-shows/MKG-RAG-Bench isolates retrieval in multimodal knowledge graph RAG and finds it is the bottleneck. Adding images and graph edges costs more without guaranteed accuracy.Sun, 28 Jun 2026 09:06:23 GMTGroundy Editorial2026-06-28T00:00:00.000Zragknowledge-graphsmultimodalretrievalbenchmarksvector-searchevaluationGroundy Editorialhttps://groundy.com/articles/vercel-sandbox-cli-reproducible-agent-runs-belong-in-ci-not-the-dashboard/https://groundy.com/articles/vercel-sandbox-cli-reproducible-agent-runs-belong-in-ci-not-the-dashboard/Vercel's sandbox CLI pairs access-token auth with snapshotting, tags, and Drives so agent runs become reproducible CI steps rather than dashboard clicks.Sun, 28 Jun 2026 08:09:46 GMTGroundy Editorial2026-06-28T00:00:00.000Zvercel-sandboxsandbox-clici-cdagent-runtimesfirecrackerreproducibilityGroundy Editorialhttps://groundy.com/articles/vercel-observability-now-tracks-redirects-and-rewrites-beside-function-errors/https://groundy.com/articles/vercel-observability-now-tracks-redirects-and-rewrites-beside-function-errors/Vercel added redirect and rewrite telemetry to Observability, putting per-route errors beside function errors and shifting routing incidents toward on-call engineers.Sun, 28 Jun 2026 07:51:37 GMTGroundy Editorial2026-06-28T00:00:00.000Zvercelobservabilityedge-routingredirectsmonitoringincident-responseGroundy Editorialhttps://groundy.com/articles/akrites-defends-open-source-code-not-in-court-what-it-can-and-cant/https://groundy.com/articles/akrites-defends-open-source-code-not-in-court-what-it-can-and-cant/Akrites, launched June 25 by the Linux Foundation, is a vulnerability-coordination body that pledges to patch abandoned packages, not a legal defense fund for maintainers.Sun, 28 Jun 2026 07:19:58 GMTGroundy Editorial2026-06-28T00:00:00.000Zopen-source-securityakritesvulnerability-disclosurelinux-foundationsecurity-incident-responsemaintainer-burnoutGroundy Editorialhttps://groundy.com/articles/cloudflare-workflows-saga-rollbacks-compensating-actions-in-serverless/https://groundy.com/articles/cloudflare-workflows-saga-rollbacks-compensating-actions-in-serverless/Cloudflare Workflows saga rollbacks move compensation into declared per-step undo handlers, exposing the idempotency assumption every saga platform quietly offloads.Sun, 28 Jun 2026 06:39:36 GMTGroundy Editorial2026-06-28T00:00:00.000Zcloudflare-workflowssaga-patternserverlessdistributed-systemsidempotencydurable-executionworkflow-orchestrationGroundy Editorialhttps://groundy.com/articles/does-more-ai-regulation-actually-reduce-corporate-control/https://groundy.com/articles/does-more-ai-regulation-actually-reduce-corporate-control/A June 2026 preprint argues more AI regulation can reduce corporate control, pushing compliance outside engineering teams and eroding oversight of deployed models.Sun, 28 Jun 2026 06:07:27 GMTGroundy Editorial2026-06-28T00:00:00.000Zai-governanceai-regulationeu-ai-actai-policycompliancerisk-managementGroundy Editorialhttps://groundy.com/articles/glm-5-2s-mit-license-and-1m-context-shift-open-source-ai-map/https://groundy.com/articles/glm-5-2s-mit-license-and-1m-context-shift-open-source-ai-map/GLM-5.2 ships MIT weights and a 1M context window, trails Claude Opus 4.8 by one percent on FrontierSWE, but the ZCode agent kernel reintroduces a Beijing dependency.Sun, 28 Jun 2026 05:14:14 GMTGroundy Editorial2026-06-28T00:00:00.000Zglm5zhipu-aiopen-source-llmzcodecode-modelsmit-licenseGroundy Editorialhttps://groundy.com/articles/vercel-now-deploys-hono-backends-with-zero-config-what-zero-leaves-out/https://groundy.com/articles/vercel-now-deploys-hono-backends-with-zero-config-what-zero-leaves-out/Vercel's zero-config Hono deploy strips boilerplate but leaves adapter duties: serveStatic() is silently remapped, edge env access diverges, and gains are vendor-stated.Sun, 28 Jun 2026 04:36:08 GMTGroundy Editorial2026-06-28T00:00:00.000Zhonovercelserverlessedge-runtimeweb-frameworksbackend-deploymentnode-jsGroundy Editorialhttps://groundy.com/articles/zcode-3-0-swaps-third-party-agent-kernels-for-a-self-built-one/https://groundy.com/articles/zcode-3-0-swaps-third-party-agent-kernels-for-a-self-built-one/ZCode 3.0 replaces its bundled Claude Code and Cline kernels with a self-built agent for GLM-5.2, so you track Zhipu's kernel cadence instead of upstream releases.Sun, 28 Jun 2026 04:11:53 GMTGroundy Editorial2026-06-28T00:00:00.000Zzcodecoding-agentagent-kernelglmclineclaude-codeelectronGroundy Editorialhttps://groundy.com/articles/diffusion-model-safety-how-training-schedule-poisoning-slips-past-prompt-filters/https://groundy.com/articles/diffusion-model-safety-how-training-schedule-poisoning-slips-past-prompt-filters/TEMPO-Diffusion gates its backdoor to a training-timestep window, so clean inference output no longer proves a clean checkpoint. Output-only audits miss the poisoning.Sun, 28 Jun 2026 01:18:14 GMTGroundy Editorial2026-06-28T00:00:00.000Zdiffusion-modelsbackdoor-attacksmodel-safetyadversarial-machine-learningsynthetic-datamodel-auditingsupply-chain-securityGroundy Editorialhttps://groundy.com/articles/look-before-move-plans-observation-before-motion-in-dynamic-3d-story-worlds/https://groundy.com/articles/look-before-move-plans-observation-before-motion-in-dynamic-3d-story-worlds/The June 2026 preprint Look-Before-Move separates what a camera observes from how it moves in dynamic 3D story worlds, but its gains stay preprint-only with no numbers.Sun, 28 Jun 2026 00:37:31 GMTGroundy Editorial2026-06-28T00:00:00.000Zvisual-attentionvlm3d-scene-understandingembodied-agentscamera-planningvisual-groundingarxivGroundy Editorialhttps://groundy.com/articles/the-macbook-neo-cursor-lag-workaround-recording-one-pixel-every-10-seconds/https://groundy.com/articles/the-macbook-neo-cursor-lag-workaround-recording-one-pixel-every-10-seconds/A one-pixel screen capture discarded every 10 seconds cures MacBook Neo cursor lag by keeping the macOS compositor awake, and works as a probe of cursor handoff stalls.Sun, 28 Jun 2026 00:15:26 GMTGroundy Editorial2026-06-28T00:00:00.000Zmacosmacbook-neocursor-lagscreencapturekitcompositorwindowserverGroundy Editorialhttps://groundy.com/articles/when-an-llm-sets-your-price-whose-long-term-value-wins/https://groundy.com/articles/when-an-llm-sets-your-price-whose-long-term-value-wins/AIGP's pricing 'alignment' targets platform GMV and ROI over 14 days with no buyer-welfare term, leaving consumers to detect price discrimination from the tag alone.Sat, 27 Jun 2026 23:21:19 GMTGroundy Editorial2026-06-27T00:00:00.000Zllm-pricingalgorithmic-pricingconsumer-welfareprice-discriminationai-ethicse-commerceGroundy Editorialhttps://groundy.com/articles/can-spec-driven-development-keep-ai-coding-agents-from-drifting/https://groundy.com/articles/can-spec-driven-development-keep-ai-coding-agents-from-drifting/A June 2026 preprint makes spec-code divergence a blocking merge condition, treating traceability as a CI gate that catches silent drift before it compounds.Sat, 27 Jun 2026 22:23:00 GMTGroundy Editorial2026-06-27T00:00:00.000Zai-coding-agentsspec-driven-developmentspec-code-driftdrift-gatesoftware-architectureagent-configscode-traceabilityGroundy Editorialhttps://groundy.com/articles/glm-5-2-qwen-3-7-and-deepseek-in-2026-a-routing-map-by-workload-not-by-rank/https://groundy.com/articles/glm-5-2-qwen-3-7-and-deepseek-in-2026-a-routing-map-by-workload-not-by-rank/GLM 5.2 sits within 1% of Opus 4.8 on FrontierSWE, Qwen 3.7 Max owns agentic workflows, and DeepSeek V3.2 covers cheap bulk inference. Route by workload, not by rank.Sat, 27 Jun 2026 21:44:12 GMTGroundy Editorial2026-06-27T00:00:00.000Zglm-5-2qwen-3-7deepseekmodel-routingchinese-aiagentic-codingopen-weightsGroundy Editorialhttps://groundy.com/articles/slm-pipeline-catches-10-of-papers-human-reviewers-missed-but-no-model-matched/https://groundy.com/articles/slm-pipeline-catches-10-of-papers-human-reviewers-missed-but-no-model-matched/An SLM ensemble caught 10% of papers human reviewers missed, yet no model matched human accuracy. Now journals must define how much SLM-screened evidence they will accept.Sat, 27 Jun 2026 21:05:06 GMTGroundy Editorial2026-06-27T00:00:00.000Zsmall-language-modelssystematic-reviewliterature-screeningresearch-methodologynlpevidence-synthesisGroundy Editorialhttps://groundy.com/articles/minimax-m3-vs-glm-5-2-whose-1m-context-claim-holds/https://groundy.com/articles/minimax-m3-vs-glm-5-2-whose-1m-context-claim-holds/Both MiniMax M3 and GLM-5.2 advertise 1M context. Only Z.ai ships benchmarks, and neither publishes independent needle-in-haystack data, so the spec sheet is not the budget.Sat, 27 Jun 2026 19:13:10 GMTGroundy Editorial2026-06-27T00:00:00.000Zlong-contextglm-5minimax-m3needle-in-haystackragcontext-windowGroundy Editorialhttps://groundy.com/articles/static-corpus-rag-the-bible-case-for-separating-churn-from-algorithm-complexity/https://groundy.com/articles/static-corpus-rag-the-bible-case-for-separating-churn-from-algorithm-complexity/Fixed-corpus RAG collapses re-chunking, freshness sync, and citation grounding. The Bible's book.chapter.verse scheme isolates churn-driven complexity from the algorithmic.Sat, 27 Jun 2026 17:34:49 GMTGroundy Editorial2026-06-27T00:00:00.000Zragstatic-corpusretrievalchunkingcorpus-designvector-searchcitation-groundingGroundy Editorialhttps://groundy.com/articles/vercels-kiko-milano-black-friday-case-study-what-the-scaling-claims-skip/https://groundy.com/articles/vercels-kiko-milano-black-friday-case-study-what-the-scaling-claims-skip/Vercel's KIKO Milano case study has no QPS, cost, or cold-start data. Collapsing skips checkout paths, Fluid savings assume I/O-bound work. Run the numbers before the peak.Sat, 27 Jun 2026 16:56:50 GMTGroundy Editorial2026-06-27T00:00:00.000Zvercelserverlessfluid-computeincremental-static-regenerationecommerce-infrastructurerequest-collapsingcapacity-planningGroundy Editorialhttps://groundy.com/articles/turbopack-moved-into-next-js-not-out-why-non-next-js-teams-choose-rspack-or-vite/https://groundy.com/articles/turbopack-moved-into-next-js-not-out-why-non-next-js-teams-choose-rspack-or-vite/Vercel's 'Moving Homes' post deepened Turbopack's Next.js coupling, not loosened it. For non-Next.js teams in 2026, the bundler decision is between Rspack and Vite.Sat, 27 Jun 2026 15:55:24 GMTGroundy Editorial2026-06-27T00:00:00.000Zturbopackrspackvitebundlerswebpacknextjsbuild-toolsGroundy Editorialhttps://groundy.com/articles/combining-llms-doesnt-escape-shared-failures-a-67-model-test/https://groundy.com/articles/combining-llms-doesnt-escape-shared-failures-a-67-model-test/A 67-model test proves ensemble accuracy cannot exceed 1 minus β. Pairwise correlation underprices β by 2.5x, making multi-model agreement an unreliable governance check.Sat, 27 Jun 2026 15:14:49 GMTGroundy Editorial2026-06-27T00:00:00.000Zllm-ensemblesai-governancemodel-routingco-failuremulti-agent-systemsai-reliabilityGroundy Editorialhttps://groundy.com/articles/deepseek-v4-1-flash-vs-qwen-3-7-vs-llama-4-5-june-2026-hf-trending-ranks/https://groundy.com/articles/deepseek-v4-1-flash-vs-qwen-3-7-vs-llama-4-5-june-2026-hf-trending-ranks/DeepSeek V4.1 Flash led Hugging Face trending in June 2026 within one week, and five of the top ten slots went to Chinese labs. Trending measures velocity, not installs.Sat, 27 Jun 2026 14:55:33 GMTGroundy Editorial2026-06-27T00:00:00.000Zopen-weight-modelsdeepseekhugging-facemodel-comparisonqwenllamachinese-aiGroundy Editorialhttps://groundy.com/articles/bandit-algorithms-let-non-experts-auto-select-the-best-llm-jailbreak/https://groundy.com/articles/bandit-algorithms-let-non-experts-auto-select-the-best-llm-jailbreak/A June 2026 arXiv preprint uses bandit algorithms to auto-select jailbreaks, hitting 97% ASR on open-weight LLMs and invalidating blocklist-based defenses.Sat, 27 Jun 2026 13:50:28 GMTGroundy Editorial2026-06-27T00:00:00.000Zllm-securityjailbreakingbandit-algorithmsai-safetyred-teamingautomated-attacksGroundy Editorialhttps://groundy.com/articles/vercel-postgres-vs-neon-vs-supabase-when-the-bundled-db-wins/https://groundy.com/articles/vercel-postgres-vs-neon-vs-supabase-when-the-bundled-db-wins/Vercel Postgres is a Neon resell now owned by Databricks. The bundled database trims setup friction for Next.js teams but stacks three vendors where most assume one.Sat, 27 Jun 2026 11:49:21 GMTGroundy Editorial2026-06-27T00:00:00.000Zvercel-postgresneonsupabaseserverless-postgresdatabase-lock-inpostgresGroundy Editorialhttps://groundy.com/articles/125-targeted-wikipedia-edits-left-a-detectable-signal-in-llama-pretraining/https://groundy.com/articles/125-targeted-wikipedia-edits-left-a-detectable-signal-in-llama-pretraining/125 Wikipedia edits produced significant attribution signals in Llama 3.1 8B and Llama-3.2-1B, showing pretraining does not average out targeted high-weight-source edits.Sat, 27 Jun 2026 11:27:57 GMTGroundy Editorial2026-06-27T00:00:00.000Zllm-trainingwikipediadata-provenancealignmentpretrainingattributionGroundy Editorialhttps://groundy.com/articles/fine-tuning-a-20b-llm-with-rlhf-on-a-24gb-gpu-what-fits/https://groundy.com/articles/fine-tuning-a-20b-llm-with-rlhf-on-a-24gb-gpu-what-fits/The 20B RLHF on 24GB claim is real but the VRAM cost is the duplicated reward model, not the LoRA adapters. Batch size, sequence length, and throughput pay the price.Sat, 27 Jun 2026 10:48:26 GMTGroundy Editorial2026-06-27T00:00:00.000Zrlhfqloraloragpu-memoryfine-tuningppodpoGroundy Editorialhttps://groundy.com/articles/vercel-cli-50-0-0-post-link-auto-pull-and-a-breaking-ls-change-for-ci-scripts/https://groundy.com/articles/vercel-cli-50-0-0-post-link-auto-pull-and-a-breaking-ls-change-for-ci-scripts/Vercel CLI 50.0.0 adds post-link env pull and masked variable input, but its stricter ls parsing is a breaking change for CI scripts that pass extra arguments.Sat, 27 Jun 2026 09:58:40 GMTGroundy Editorial2026-06-27T00:00:00.000Zvercel-clienvironment-variablesci-cdsecrets-managementdeploymentvercelGroundy Editorialhttps://groundy.com/articles/vercel-fluid-compute-shifts-cold-start-cost-to-sparse-tail-region-traffic/https://groundy.com/articles/vercel-fluid-compute-shifts-cold-start-cost-to-sparse-tail-region-traffic/Vercel's Fluid Compute runs multiple requests per warm instance, narrowing which traffic triggers cold starts and shifting tail-latency risk onto spiky workloads.Sat, 27 Jun 2026 09:24:24 GMTGroundy Editorial2026-06-27T00:00:00.000Zfluid-computecold-startsserverlessedge-runtimevercelnextjslatencyGroundy Editorialhttps://groundy.com/articles/vercel-flat-rate-cdn-beta-break-even-math-for-spiky-workloads-tax-for-the-rest/https://groundy.com/articles/vercel-flat-rate-cdn-beta-break-even-math-for-spiky-workloads-tax-for-the-rest/Vercel's Flat Rate CDN beta replaces per-GB egress with a fixed fee; spiky workloads win, steady low-traffic sites pay more, and the Cloudflare-fronting cost case weakens.Sat, 27 Jun 2026 08:52:29 GMTGroundy Editorial2026-06-27T00:00:00.000Zvercelcdnbandwidth-pricingcloudflareedge-infrastructurecloud-costsGroundy Editorialhttps://groundy.com/articles/indeed-70-of-sponsored-applications-now-route-through-ai-ranking-not-keyword/https://groundy.com/articles/indeed-70-of-sponsored-applications-now-route-through-ai-ranking-not-keyword/Indeed reports 70% of sponsored applications now route through GPT ranking, not keyword search. ATS vendors screen a pre-filtered pool with no insight into the ranking logic.Sat, 27 Jun 2026 08:35:58 GMTGroundy Editorial2026-06-27T00:00:00.000Zindeedjob-matchingats-vendorsopenaikeyword-searchhiring-technologyrecruiting-aiGroundy Editorialhttps://groundy.com/articles/can-sae-features-stop-llms-from-forgetting-during-continual-learning/https://groundy.com/articles/can-sae-features-stop-llms-from-forgetting-during-continual-learning/A June 2026 preprint anchors continual-learning retention in sparse autoencoder features instead of weights, removing replay buffers but tying quality to SAE coverage.Sat, 27 Jun 2026 07:59:23 GMTGroundy Editorial2026-06-27T00:00:00.000Zcontinual-learningsparse-autoencoderscatastrophic-forgettinginterpretabilityllm-fine-tuningmodel-regularizationGroundy Editorialhttps://groundy.com/articles/jetbrains-junie-vs-cursor-vs-github-copilot-how-ide-context-changes-agent/https://groundy.com/articles/jetbrains-junie-vs-cursor-vs-github-copilot-how-ide-context-changes-agent/JetBrains Junie runs inside IntelliJ's live type model, giving refactors a validation layer Cursor and Copilot lack. The cost: a narrower model menu and lower portability.Sat, 27 Jun 2026 06:55:25 GMTGroundy Editorial2026-06-27T00:00:00.000Zjetbrainscursorgithub-copilotide-agentsai-coding-toolsrefactoringdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/rag-poisoning-hijacks-model-attention-not-just-retrieval-ranking/https://groundy.com/articles/rag-poisoning-hijacks-model-attention-not-just-retrieval-ranking/Eyes-on-Me (ICML 2026) shows attention attractors in poisoned documents redirect generator focus post-retrieval, lifting attack success from 21.9% to 57.8% across 18 settings.Sat, 27 Jun 2026 05:44:55 GMTGroundy Editorial2026-06-27T00:00:00.000Zrag-securityrag-poisoningattention-mechanismllm-securityadversarial-mlvector-databaseretrieval-augmented-generationGroundy Editorialhttps://groundy.com/articles/can-ai-agents-audit-the-insides-of-other-ai-models/https://groundy.com/articles/can-ai-agents-audit-the-insides-of-other-ai-models/A June 2026 arXiv preprint finds LLM agents can explain another model's circuits but fail at validation. The auditor is itself an unverified LLM in the same model class.Sat, 27 Jun 2026 05:09:59 GMTGroundy Editorial2026-06-27T00:00:00.000Zmechanistic-interpretabilityai-agentsinterpretabilityai-safetyai-auditingmodel-transparencyGroundy Editorialhttps://groundy.com/articles/vercel-blobs-20-region-model-one-store-global-cache-no-cross-region-replication/https://groundy.com/articles/vercel-blobs-20-region-model-one-store-global-cache-no-cross-region-replication/Vercel Blob stores are pinned to one of 20 regions, fronted by a 126-PoP CDN. Writes do not replicate and there is no documented cross-region consistency guarantee.Sat, 27 Jun 2026 04:22:10 GMTGroundy Editorial2026-06-27T00:00:00.000Zvercel-blobobject-storagecdndistributed-systemsdeveloper-toolsdata-consistencycloud-storageGroundy Editorialhttps://groundy.com/articles/can-a-30b-model-post-train-itself-a-evolve-training-tests-autonomous/https://groundy.com/articles/can-a-30b-model-post-train-itself-a-evolve-training-tests-autonomous/A 30B Nemotron model post-trained itself to 8th of 4,000 on NVIDIA's leaderboard, then detected its own internal metric lying and rewrote its evaluation frame mid-run.Sat, 27 Jun 2026 03:51:47 GMTGroundy Editorial2026-06-27T00:00:00.000Zautonomous-trainingllm-post-trainingreinforcement-learningreward-hackingproxy-misalignmentai-evaluationnemotronGroundy Editorialhttps://groundy.com/articles/cve-2026-lgtm-and-the-limits-of-trust-in-automated-advisory-intake/https://groundy.com/articles/cve-2026-lgtm-and-the-limits-of-trust-in-automated-advisory-intake/CVE IDs certify disclosure, not exploitability. Scanners that ingest the feed without VEX attestation treat every advisory that cleared CNA intake as a confirmed risk.Sat, 27 Jun 2026 02:11:58 GMTGroundy Editorial2026-06-27T00:00:00.000Zcvevulnerability-disclosuresbomcnavexdependency-scanningsupply-chain-securityGroundy Editorialhttps://groundy.com/articles/task-focused-vlms-suppress-hazards-they-detect-in-isolation-june-2026-preprint/https://groundy.com/articles/task-focused-vlms-suppress-hazards-they-detect-in-isolation-june-2026-preprint/A June 2026 preprint finds VLMs suppress hazard reports under task load while passing direct-probe evals, indicating safety scores overstate protection in actual deployment.Sat, 27 Jun 2026 00:46:54 GMTGroundy Editorial2026-06-27T00:00:00.000Zvlm-safetysafety-benchmarkinginattentional-gapmultimodal-modelstask-conditioningvision-language-modelsGroundy Editorialhttps://groundy.com/articles/sharelock-splits-mcp-poisoning-across-tools-defeating-per-tool-scanners/https://groundy.com/articles/sharelock-splits-mcp-poisoning-across-tools-defeating-per-tool-scanners/ShareLock splits an MCP poisoning payload across tool descriptions via Shamir's threshold scheme. No individual share is flagged. Combined, attack success tops 90%.Fri, 26 Jun 2026 23:24:17 GMTGroundy Editorial2026-06-26T00:00:00.000Zmcp-securitytool-poisoningsecret-sharingai-agentsprompt-injectionsupply-chain-attacksllm-securityGroundy Editorialhttps://groundy.com/articles/open-weight-llm-leaderboards-2026-where-deepseek-qwen-and-glm-rank/https://groundy.com/articles/open-weight-llm-leaderboards-2026-where-deepseek-qwen-and-glm-rank/DataLearner's June 2026 snapshot ranks GLM-5.2 seventh by HLE at 54.70 and places no Chinese flagship in the overall top three, undercutting launch-day claims.Fri, 26 Jun 2026 22:09:15 GMTGroundy Editorial2026-06-26T00:00:00.000Zllm-leaderboardsopen-weight-modelsai-benchmarkschinese-ai-modelsmodel-evaluationmodel-selectionGroundy Editorialhttps://groundy.com/articles/how-vercel-connect-brokers-scoped-agent-access-to-internal-services/https://groundy.com/articles/how-vercel-connect-brokers-scoped-agent-access-to-internal-services/Vercel Connect brokers agent access to private databases and APIs through a managed layer, removing secrets from the runtime but shifting the trust boundary to Vercel.Fri, 26 Jun 2026 19:34:16 GMTGroundy Editorial2026-06-26T00:00:00.000Zvercel-connectagent-infrastructuresecret-managementserverless-agentscloud-securityvendor-lock-inGroundy Editorialhttps://groundy.com/articles/qwen3-7-maxs-top-ranked-claim-vs-the-artificial-analysis-index/https://groundy.com/articles/qwen3-7-maxs-top-ranked-claim-vs-the-artificial-analysis-index/Alibaba framed Qwen3.7-Max as globally top-ranked at launch. The Artificial Analysis index scored it 56.6 and ranked it fifth overall, behind Claude and GPT.Fri, 26 Jun 2026 18:31:00 GMTGroundy Editorial2026-06-26T00:00:00.000Zqwendeepseekchinese-ai-modelsllm-benchmarksmodel-evaluationfrontier-modelsGroundy Editorialhttps://groundy.com/articles/can-knowledge-based-pull-requests-make-agent-contributions-auditable/https://groundy.com/articles/can-knowledge-based-pull-requests-make-agent-contributions-auditable/A June 2026 preprint makes agent PRs auditable by splitting knowledge admission from code merge and regenerating code via a project-owned agent, backed only by a 7-PR pilot.Fri, 26 Jun 2026 17:48:51 GMTGroundy Editorial2026-06-26T00:00:00.000Zagent-pull-requestscode-reviewagent-verificationpolicy-as-codemaintainer-burdensupply-chain-securityGroundy Editorialhttps://groundy.com/articles/where-deepseek-weights-actually-run-on-vercels-ai-gateway/https://groundy.com/articles/where-deepseek-weights-actually-run-on-vercels-ai-gateway/DeepSeek hit 17% of tokens on Vercel's AI Gateway in May 2026, but no source confirms where the weights run. Jurisdiction, not model origin, is the new gate.Fri, 26 Jun 2026 17:01:09 GMTGroundy Editorial2026-06-26T00:00:00.000Zvercel-ai-gatewaydeepseekinference-jurisdictionmodel-routingazuredata-sovereigntyGroundy Editorialhttps://groundy.com/articles/prompt-injection-in-ai-resume-screening-single-vs-multi-injection-attacks/https://groundy.com/articles/prompt-injection-in-ai-resume-screening-single-vs-multi-injection-attacks/A June 2026 preprint plants prompt injection in résumés fed to LLM screeners, flipping rankings when few candidates inject and forcing vendors to isolate untrusted input.Fri, 26 Jun 2026 16:32:48 GMTGroundy Editorial2026-06-26T00:00:00.000Zprompt-injectionllm-securityresume-screeningai-hiringadversarial-attackshr-techGroundy Editorialhttps://groundy.com/articles/openais-tanstack-npm-writeup-shifts-dependency-control-burden-onto-ai-tooling/https://groundy.com/articles/openais-tanstack-npm-writeup-shifts-dependency-control-burden-onto-ai-tooling/OpenAI's TanStack npm writeup is its second macOS signing compromise within a month, and it raises the dependency-control bar for every team pulling npm into AI tooling.Fri, 26 Jun 2026 16:14:28 GMTGroundy Editorial2026-06-26T00:00:00.000Zsupply-chain-securitynpmcode-signingdependency-managementopenaici-cdGroundy Editorialhttps://groundy.com/articles/vercel-detects-bun-lockfiles-for-affected-builds-as-text-bun-lock-stabilizes/https://groundy.com/articles/vercel-detects-bun-lockfiles-for-affected-builds-as-text-bun-lock-stabilizes/Vercel now detects Bun lockfiles to skip untouched monorepo builds, and Bun v1.2 defaults to a text bun.lock that diffs in git, so teams can retire the binary bun.lockb.Fri, 26 Jun 2026 14:50:28 GMTGroundy Editorial2026-06-26T00:00:00.000Zbunvercellockfilemonorepobuild-skippingjavascriptGroundy Editorialhttps://groundy.com/articles/apple-raises-mac-and-ipad-prices-as-ai-memory-demand-drains-dram-supply/https://groundy.com/articles/apple-raises-mac-and-ipad-prices-as-ai-memory-demand-drains-dram-supply/Apple's Mac and iPad price hikes trace back to AI demand draining DRAM supply: HBM stacks now consume the same wafers, leaving every memory-heavy device carrying an AI tax.Fri, 26 Jun 2026 14:16:54 GMTGroundy Editorial2026-06-26T00:00:00.000Zdram-pricinghbmmemory-supply-chainappleconsumer-hardwareai-capexcomponent-inflationGroundy Editorialhttps://groundy.com/articles/vercels-anti-lock-in-pitch-what-the-open-source-bet-still-locks/https://groundy.com/articles/vercels-anti-lock-in-pitch-what-the-open-source-bet-still-locks/Vercel markets Next.js and the AI SDK as open source and portable, but the paid platform, from deploy previews to Fluid Compute, does not travel with the code.Fri, 26 Jun 2026 12:47:00 GMTGroundy Editorial2026-06-26T00:00:00.000Zvercelvendor-lock-innext-jsopen-sourceplatform-engineeringcloud-migrationGroundy Editorialhttps://groundy.com/articles/emotion-vectors-replicate-in-open-source-llms-but-steering-is-unproven/https://groundy.com/articles/emotion-vectors-replicate-in-open-source-llms-but-steering-is-unproven/A June 2026 preprint shows the open-weight models Apertus-8B and Gemma-4-E4B encode emotion vectors at r=0.76 to 0.83, but does not prove steering controls behavior.Fri, 26 Jun 2026 12:17:46 GMTGroundy Editorial2026-06-26T00:00:00.000Zactivation-steeringemotion-vectorsopen-weight-modelsrepresentation-engineeringllm-interpretabilityllm-alignmentGroundy Editorialhttps://groundy.com/articles/does-tree-of-thought-reasoning-scale-to-billion-user-modeling/https://groundy.com/articles/does-tree-of-thought-reasoning-scale-to-billion-user-modeling/ScaleToT distills tree-of-thought reasoning into a profile encoder that serves billion-user recommenders without per-user LLM calls, lifting LT30 by 6.738% in an A/B test.Fri, 26 Jun 2026 11:41:16 GMTGroundy Editorial2026-06-26T00:00:00.000Ztree-of-thoughtrecommendation-systemsuser-modelingcold-startknowledge-distillationllm-reasoningGroundy Editorialhttps://groundy.com/articles/do-ai-agents-hold-up-outside-familiar-environments-a-new-eval-says/https://groundy.com/articles/do-ai-agents-hold-up-outside-familiar-environments-a-new-eval-says/A 100-task benchmark finds the frontier AI agent clears 19.1% of vision-heavy tasks where non-experts top 80%. Leaderboard scores don't transfer to deployment.Fri, 26 Jun 2026 10:12:51 GMTGroundy Editorial2026-06-26T00:00:00.000Zagent-benchmarksai-agentsllm-evaluationbenchmark-validityagentic-systemsagent-deploymentGroundy Editorialhttps://groundy.com/articles/vercel-adds-tag-based-cdn-cache-invalidation-surrogate-keys-at-the-edge/https://groundy.com/articles/vercel-adds-tag-based-cdn-cache-invalidation-surrogate-keys-at-the-edge/Vercel's January 2026 Vercel-Cache-Tag ship brings surrogate-key cache invalidation to every plan, moving the cache contract into application-owned tag strings.Fri, 26 Jun 2026 09:51:07 GMTGroundy Editorial2026-06-26T00:00:00.000Zcache-invalidationcdnsurrogate-keysverceledge-cachingcache-tagsGroundy Editorialhttps://groundy.com/articles/how-much-repo-structure-does-a-coding-agent-actually-need/https://groundy.com/articles/how-much-repo-structure-does-a-coding-agent-actually-need/ISSTA 2026 ablation: lightweight call topology halves code agent run variance, and forward edges in hub-heavy repos degrade results. More structure stops paying off fast.Fri, 26 Jun 2026 09:10:58 GMTGroundy Editorial2026-06-26T00:00:00.000Zcode-agentsstatic-analysisrepo-structurellm-contextdeterministic-anchoringtoken-efficiencyagent-evaluationGroundy Editorialhttps://groundy.com/articles/mcp-vs-a2a-two-agent-protocols-one-integration-layer-decision/https://groundy.com/articles/mcp-vs-a2a-two-agent-protocols-one-integration-layer-decision/Anthropic's MCP and Google's A2A both use JSON-RPC 2.0 but solve different problems. Here is the architectural distinction, the security gap, and when you actually need both.Fri, 26 Jun 2026 09:00:00 GMTGroundy Editorial2026-06-26T00:00:00.000ZMCPA2Aagent-protocolsmulti-agentLLM-toolsAI-infrastructureJSON-RPCGroundy Editorialhttps://groundy.com/articles/open-source-ai-adoption-index-uses-chat-logs-and-o-net-data-to-replicate/https://groundy.com/articles/open-source-ai-adoption-index-uses-chat-logs-and-o-net-data-to-replicate/A 2026 arXiv preprint open-sources an AI adoption index from chat logs and O*NET data; finance, CS, and arts top adoption. AI passes workflows but errs on specific tool calls.Fri, 26 Jun 2026 08:04:56 GMTGroundy Editorial2026-06-26T00:00:00.000Zai-adoptionopen-weight-modelsoccupational-aikimiai-evaluationprocurementarxivGroundy Editorialhttps://groundy.com/articles/glm-5-2-fast-on-vercel-ai-gateway-what-routing-through-wafer-actually-buys/https://groundy.com/articles/glm-5-2-fast-on-vercel-ai-gateway-what-routing-through-wafer-actually-buys/Vercel AI Gateway reportedly routes GLM 5.2 Fast through Wafer, putting Zhipu's 754B-parameter MoE coding model one config entry from any Vercel app. Routing is unverified.Fri, 26 Jun 2026 06:46:27 GMTGroundy Editorial2026-06-26T00:00:00.000Zvercel-ai-gatewayglm-5-2inference-providersmoe-modelsopen-weight-modelszhipu-aiapi-gateway-routingGroundy Editorialhttps://groundy.com/articles/openai-pushes-its-ipo-into-2027-clearing-the-lane-for-anthropics/https://groundy.com/articles/openai-pushes-its-ipo-into-2027-clearing-the-lane-for-anthropics/OpenAI is leaning toward a 2027 IPO while Anthropic's S-1 is already in SEC review, handing Anthropic the role of setting the first public frontier-model valuation template.Fri, 26 Jun 2026 06:18:36 GMTGroundy Editorial2026-06-26T00:00:00.000Zopenai-ipoanthropic-iposec-filingai-valuationfrontier-modelsventure-capitalpublic-marketsGroundy Editorialhttps://groundy.com/articles/vercel-cdn-cache-tags-vs-path-purging-when-tag-invalidation-wins/https://groundy.com/articles/vercel-cdn-cache-tags-vs-path-purging-when-tag-invalidation-wins/Vercel's tag-based cache invalidation shifts cost from each purge call to per-response edge metadata, forcing teams to design a low-cardinality tag taxonomy up front.Fri, 26 Jun 2026 05:33:50 GMTGroundy Editorial2026-06-26T00:00:00.000Zcache-invalidationvercelcdncache-tagsedge-cachingtaxonomy-designGroundy Editorialhttps://groundy.com/articles/prisma-joins-the-vercel-marketplace-the-orm-becomes-the-database-vendor/https://groundy.com/articles/prisma-joins-the-vercel-marketplace-the-orm-becomes-the-database-vendor/Prisma Postgres now bills through Vercel Marketplace, turning the ORM company into your database vendor. Transactional pool limits constrain serverless workloads.Fri, 26 Jun 2026 04:50:59 GMTGroundy Editorial2026-06-26T00:00:00.000Zprisma-postgresvercel-marketplaceconnection-poolingserverless-databaseormpostgresGroundy Editorialhttps://groundy.com/articles/openais-chatgpt-atlas-treats-prompt-injection-as-unfixed-not-patched/https://groundy.com/articles/openais-chatgpt-atlas-treats-prompt-injection-as-unfixed-not-patched/OpenAI frames ChatGPT Atlas's prompt-injection hardening as continuous rather than a closed patch, pushing the burden onto runtime controls for agent builders.Fri, 26 Jun 2026 04:16:54 GMTGroundy Editorial2026-06-26T00:00:00.000Zprompt-injectionllm-securitychatgpt-atlasbrowser-agentsruntime-controlsred-teamingGroundy Editorialhttps://groundy.com/articles/vercel-cli-now-signs-blob-urls-moving-access-control-off-the-app-server/https://groundy.com/articles/vercel-cli-now-signs-blob-urls-moving-access-control-off-the-app-server/Vercel CLI 5.14.5 adds vercel blob presign for scoped, time-limited blob access without per-request app-server auth. Revocation requires expiry or key rotation.Fri, 26 Jun 2026 03:29:54 GMTGroundy Editorial2026-06-26T00:00:00.000Zvercel-blobsigned-urlsvercel-cliaccess-controlblob-storagepresigned-urlsdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/openknowledge-keeps-markdown-local-but-routes-the-vault-to-cloud-coding-agents/https://groundy.com/articles/openknowledge-keeps-markdown-local-but-routes-the-vault-to-cloud-coding-agents/OpenKnowledge is a GPL-3.0 markdown editor whose built-in MCP server hands local vault files to cloud coding agents. Local storage survives; local-only inference does not.Fri, 26 Jun 2026 01:46:49 GMTGroundy Editorial2026-06-26T00:00:00.000Zopen-sourcemcplocal-firstmarkdowncoding-agentsknowledge-managementGroundy Editorialhttps://groundy.com/articles/can-llms-debug-verilog-veripilot-puts-an-agent-on-rtl-errors/https://groundy.com/articles/can-llms-debug-verilog-veripilot-puts-an-agent-on-rtl-errors/VeriPilot wraps an LLM in a four-phase Verilog debug loop with a golden reference, lifting GPT-4o repair on CVDP from 54.3% to 85.71% in an unreproduced v1 preprint.Fri, 26 Jun 2026 01:21:31 GMTGroundy Editorial2026-06-26T00:00:00.000Zverilogrtl-debugginghardware-verificationllm-agentsautomated-program-repairllm-for-hardwareGroundy Editorialhttps://groundy.com/articles/buying-domains-from-the-vercel-cli-what-domain-search-folds-into-deploys/https://groundy.com/articles/buying-domains-from-the-vercel-cli-what-domain-search-folds-into-deploys/Vercel folded domain search, pricing, and purchase into the same CLI that runs deploys, so one token can register and attach a domain with no documented spend cap.Fri, 26 Jun 2026 00:59:54 GMTGroundy Editorial2026-06-26T00:00:00.000Zvercel-clidomain-registrationci-cdcloud-billingdomain-provisioningdevopsGroundy Editorialhttps://groundy.com/articles/openai-on-aws-bedrock-routing-math-to-run-before-you-move-traffic/https://groundy.com/articles/openai-on-aws-bedrock-routing-math-to-run-before-you-move-traffic/OpenAI on AWS Bedrock is unconfirmed, but a loosened Microsoft deal would let AWS shops draw down committed spend rather than pay cross-cloud egress for GPT-class models.Fri, 26 Jun 2026 00:25:36 GMTGroundy Editorial2026-06-26T00:00:00.000Zaws-bedrockopenaiinference-routingmulti-cloudcommitted-spendmodel-paritycloud-egressGroundy Editorialhttps://groundy.com/articles/vercels-function-observability-what-native-metrics-replace-and-what-they-dont/https://groundy.com/articles/vercels-function-observability-what-native-metrics-replace-and-what-they-dont/Vercel Observability surfaces per-function cost and error metrics natively, retiring basic Datadog for cost attribution, but cannot trace cross-service latency chains.Thu, 25 Jun 2026 23:59:23 GMTGroundy Editorial2026-06-25T00:00:00.000Zvercel-observabilityserverless-monitoringapmdistributed-tracingcost-attributionfunction-metricsGroundy Editorialhttps://groundy.com/articles/aws-databases-on-the-vercel-marketplace-the-cross-cloud-latency-tax/https://groundy.com/articles/aws-databases-on-the-vercel-marketplace-the-cross-cloud-latency-tax/Vercel's AWS Databases marketplace streamlines IAM and billing but leaves cross-region latency and pooling on the buyer. The 64ms benchmark holds only on greenfield accounts.Thu, 25 Jun 2026 23:29:07 GMTGroundy Editorial2026-06-25T00:00:00.000Zvercelaws-rdsconnection-poolingfluid-computerds-proxylatencyGroundy Editorialhttps://groundy.com/articles/can-you-rewind-an-ai-agent-mid-run-reversible-traces-say-yes/https://groundy.com/articles/can-you-rewind-an-ai-agent-mid-run-reversible-traces-say-yes/Shepherd records agent runs as reversible Git-like traces, letting a meta-agent rewind to any step, edit state, and replay the suffix without restarting from scratch.Thu, 25 Jun 2026 22:19:20 GMTGroundy Editorial2026-06-25T00:00:00.000Zai-agentsagent-tracesreversible-executionmeta-agentsagent-debugginglong-horizon-agentsGroundy Editorialhttps://groundy.com/articles/task-decomposition-helps-llms-by-shrinking-output-space-not-by-cutting-labeling/https://groundy.com/articles/task-decomposition-helps-llms-by-shrinking-output-space-not-by-cutting-labeling/No preprint backs decomposed annotation as an LLM labeling-cost fix. Where measured, gains come from shrinking a model's output space, not from splitting annotation work.Thu, 25 Jun 2026 21:54:28 GMTGroundy Editorial2026-06-25T00:00:00.000Ztask-decompositiondata-labelingrlhfmodel-distillationpreference-datafine-tuningGroundy Editorialhttps://groundy.com/articles/can-ai-agents-reproduce-published-research-core-bench-tests/https://groundy.com/articles/can-ai-agents-reproduce-published-research-core-bench-tests/CORE-Bench grades agents on re-running a paper's code to recover its reported numbers. The best baseline hit 21% on the hardest tier, leaving most misses unexplained.Thu, 25 Jun 2026 20:47:57 GMTGroundy Editorial2026-06-25T00:00:00.000Zreproducibilityai-agentsbenchmarkscomputational-reproducibilityscientific-verificationagent-evaluationGroundy Editorialhttps://groundy.com/articles/can-provable-bounds-defend-llm-fine-tuning-against-poisoned-data/https://groundy.com/articles/can-provable-bounds-defend-llm-fine-tuning-against-poisoned-data/BBoxER, a 2025 gradient-free post-training method, claims non-vacuous poisoning-robustness bounds for LLMs. The abstract never states how tight those bounds are.Thu, 25 Jun 2026 20:09:37 GMTGroundy Editorial2026-06-25T00:00:00.000Zllm-fine-tuningdata-poisoningmodel-robustnessai-securitygeneralization-boundsblack-box-optimizationGroundy Editorialhttps://groundy.com/articles/yarn-berry-on-vercel-a-build-cache-gap-with-no-documented-fix/https://groundy.com/articles/yarn-berry-on-vercel-a-build-cache-gap-with-no-documented-fix/Vercel's build cache excludes Yarn Berry's .yarn layout, so node-linker monorepos re-resolve dependencies every deploy. A 2024 YARN_CACHE_FOLDER workaround remains the fix.Thu, 25 Jun 2026 19:57:16 GMTGroundy Editorial2026-06-25T00:00:00.000Zyarn-berryvercelbuild-cachemonoreponode-jscontinuous-integrationpnpGroundy Editorialhttps://groundy.com/articles/turso-on-the-vercel-marketplace-edge-sqlite-vs-the-serverless-connection-pool/https://groundy.com/articles/turso-on-the-vercel-marketplace-edge-sqlite-vs-the-serverless-connection-pool/Turso on the Vercel Marketplace embeds SQLite in serverless functions, eliminating the read-side connection pool at the cost of write conflict aborts and replica lag.Thu, 25 Jun 2026 19:07:05 GMTGroundy Editorial2026-06-25T00:00:00.000Ztursolibsqlsqlitevercelserverlessedge-databaseconnection-poolingGroundy Editorialhttps://groundy.com/articles/sveltekit-can-run-nextauth-js-but-auth-js-moved-to-better-auth/https://groundy.com/articles/sveltekit-can-run-nextauth-js-but-auth-js-moved-to-better-auth/Auth.js v5 ships SvelteKit, SolidStart, Express, and Qwik bindings, freeing NextAuth.js from Next.js. But the project now lives under Better Auth, the new greenfield default.Thu, 25 Jun 2026 18:22:25 GMTGroundy Editorial2026-06-25T00:00:00.000Zauth-jssveltekitauthenticationbetter-authnextjsweb-frameworksGroundy Editorialhttps://groundy.com/articles/how-on-device-ai-agents-keep-learning-by-forgetting-on-purpose/https://groundy.com/articles/how-on-device-ai-agents-keep-learning-by-forgetting-on-purpose/A frozen on-device agent learns new tasks by forgetting low-value memory on purpose, cutting its footprint 2.7x and prompt-injection success from 0.75 to zero.Thu, 25 Jun 2026 17:57:29 GMTGroundy Editorial2026-06-25T00:00:00.000Zagent-memoryon-device-aicontinual-learningllm-agentsprompt-injectionedge-inferenceGroundy Editorialhttps://groundy.com/articles/fired-for-building-the-google-workspace-cli-the-risk-of-depending-on-unofficial/https://groundy.com/articles/fired-for-building-the-google-workspace-cli-the-risk-of-depending-on-unofficial/A Google engineer says he was fired for building gws, the unofficial Workspace CLI. With no SLA, teams that wired it into CI now own the migration.Thu, 25 Jun 2026 17:29:14 GMTGroundy Editorial2026-06-25T00:00:00.000Zgoogle-workspaceclibus-factoropen-sourcedeveloper-toolsdependency-managementGroundy Editorialhttps://groundy.com/articles/flow-matching-vs-u-net-a-skip-free-backbone-for-speech-models/https://groundy.com/articles/flow-matching-vs-u-net-a-skip-free-backbone-for-speech-models/A June 2026 preprint argues U-Net skip connections leak noise into flow-matching speech decoders, and a codec-supervised skip-free backbone can replace them at parity.Thu, 25 Jun 2026 17:12:17 GMTGroundy Editorial2026-06-25T00:00:00.000Zflow-matchingspeech-enhancementu-netneural-codecdiffusion-modelsaudio-modelsGroundy Editorialhttps://groundy.com/articles/measuring-llm-safety-by-refusal-alignment-instead-of-attack-success-rate/https://groundy.com/articles/measuring-llm-safety-by-refusal-alignment-instead-of-attack-success-rate/A June 2026 preprint proposes RAS, a white-box metric that scores LLM safety by hidden-state refusal alignment rather than blocked output, challenging ASR-only leaderboards.Thu, 25 Jun 2026 16:58:28 GMTGroundy Editorial2026-06-25T00:00:00.000Zllm-safetyrefusal-alignmentai-evaluationsafety-benchmarksinterpretabilityjailbreakingGroundy Editorialhttps://groundy.com/articles/poisoning-physics-informed-neural-networks-slips-past-loss-based-validation/https://groundy.com/articles/poisoning-physics-informed-neural-networks-slips-past-loss-based-validation/A June 2026 preprint shows poisoned physics-informed neural networks hit clean training loss while their solutions diverge up to 128%, defeating loss-based validation.Thu, 25 Jun 2026 16:42:00 GMTGroundy Editorial2026-06-25T00:00:00.000Zphysics-informed-neural-networksml-securitymodel-validationadversarial-attacksscientific-machine-learningpde-solversmodel-integrityGroundy Editorialhttps://groundy.com/articles/50-years-of-aviation-certification-expose-a-structural-gap-in-ai-governance/https://groundy.com/articles/50-years-of-aviation-certification-expose-a-structural-gap-in-ai-governance/A June 2026 arXiv paper argues AI governance lacks the epoch limits and proof surfaces that 50 years of aviation certification built in, breaking one-time approval stamps.Thu, 25 Jun 2026 14:58:26 GMTGroundy Editorial2026-06-25T00:00:00.000Zai-governanceaviation-certificationdo-178cai-certificationepoch-limitsproof-surfacescomplianceGroundy Editorialhttps://groundy.com/articles/catching-llm-jailbreaks-by-watching-per-layer-entropy-not-outputs/https://groundy.com/articles/catching-llm-jailbreaks-by-watching-per-layer-entropy-not-outputs/A June 2026 paper reports jailbreaks perturb per-layer entropy of frozen LLMs before any harmful token emits, but adaptive attackers will likely follow one layer deeper.Thu, 25 Jun 2026 14:25:08 GMTGroundy Editorial2026-06-25T00:00:00.000Zjailbreak-detectionllm-securityai-safetyinterpretabilityadversarial-attacksactivation-monitoringGroundy Editorialhttps://groundy.com/articles/cost-and-access-not-ideology-drive-open-weight-chinese-model-adoption/https://groundy.com/articles/cost-and-access-not-ideology-drive-open-weight-chinese-model-adoption/The shift toward open-weight Chinese models runs on cost and access, not openness. Operators inherit the work of vetting provenance, licenses, and benchmark reproducibility.Thu, 25 Jun 2026 13:51:22 GMTGroundy Editorial2026-06-25T00:00:00.000Zopen-weightchinese-aideepseekai-procurementmodel-licensingreproducibilitytokenomicsGroundy Editorialhttps://groundy.com/articles/a-per-neuron-sequence-model-was-withdrawn-from-arxiv-as-coverage-hailed/https://groundy.com/articles/a-per-neuron-sequence-model-was-withdrawn-from-arxiv-as-coverage-hailed/TND proposed per-neuron dynamics as a sequence-modeling primitive, then was withdrawn from arXiv for accuracy errors the day before coverage called it a Transformer.Thu, 25 Jun 2026 12:04:34 GMTGroundy Editorial2026-06-25T00:00:00.000Zsequence-modelingneural-network-architecturedynamical-systemstransformersstate-space-modelsarxivGroundy Editorialhttps://groundy.com/articles/do-reasoning-tokens-actually-make-llms-safer-a-new-paper-tests/https://groundy.com/articles/do-reasoning-tokens-actually-make-llms-safer-a-new-paper-tests/A June 2026 preprint finds refusal decisions are locked at a model's first token, undercutting the safety case for premium reasoning modes billed per thinking token.Thu, 25 Jun 2026 11:32:35 GMTGroundy Editorial2026-06-25T00:00:00.000Zllm-safetyreasoning-modelschain-of-thoughtai-alignmentinference-costtest-time-computeGroundy Editorialhttps://groundy.com/articles/nub-bundles-a-bun-style-toolkit-onto-node-without-the-runtime-swap/https://groundy.com/articles/nub-bundles-a-bun-style-toolkit-onto-node-without-the-runtime-swap/Nub ships a Bun-style all-in-one Node toolkit while keeping stock V8, trading Bun's native-module breakage for Node's own startup floor in a single Rust binary.Thu, 25 Jun 2026 11:05:52 GMTGroundy Editorial2026-06-25T00:00:00.000Znode-jsjavascript-toolingnubbunpackage-managersdeveloper-experienceGroundy Editorialhttps://groundy.com/articles/bot-account-lookups-miss-97-of-ai-coding-agent-commits-180m-repo-census-finds/https://groundy.com/articles/bot-account-lookups-miss-97-of-ai-coding-agent-commits-180m-repo-census-finds/A 180-million-repo census finds bot-account lookups miss 97% of Claude Code commits, a 30x recall gap that makes prior AI-agent adoption estimates a floor.Thu, 25 Jun 2026 10:34:22 GMTGroundy Editorial2026-06-25T00:00:00.000Zai-coding-agentsai-generated-codegithubdeveloper-toolsresearch-methodscode-qualityGroundy Editorialhttps://groundy.com/articles/how-reliable-are-the-llm-judges-scoring-jailbreak-attacks/https://groundy.com/articles/how-reliable-are-the-llm-judges-scoring-jailbreak-attacks/Published jailbreak attack-success rates depend on the judges scoring them. A June 2026 audit finds both judge families miscalibrated and manipulable without removing harm.Thu, 25 Jun 2026 10:04:39 GMTGroundy Editorial2026-06-25T00:00:00.000Zllm-judgejailbreakred-teamingadversarial-robustnessai-safetysafety-evaluationGroundy Editorialhttps://groundy.com/articles/pv-tam-corrects-decoding-drift-and-boundary-marker-bias-in-vlm-localization/https://groundy.com/articles/pv-tam-corrects-decoding-drift-and-boundary-marker-bias-in-vlm-localization/PV-TAM, proposed in a June 2026 arXiv preprint, corrects two structural biases in VLM localization scoring: decoding drift and modality boundary-marker contamination.Thu, 25 Jun 2026 08:46:31 GMTGroundy Editorial2026-06-25T00:00:00.000Zvision-language-modelsvlm-evaluationattention-mapslocalizationbenchmark-methodologymultimodal-aiarxiv-preprintGroundy Editorialhttps://groundy.com/articles/do-agents-md-files-actually-help-coding-agents-a-new-benchmark-tests/https://groundy.com/articles/do-agents-md-files-actually-help-coding-agents-a-new-benchmark-tests/An ETH Zurich benchmark finds AGENTS.md files don't lift task success rates but add over 20% to inference cost. A second study measures runtime savings, not success rate.Thu, 25 Jun 2026 06:53:33 GMTGroundy Editorial2026-06-25T00:00:00.000Zcoding-agentsagents-mdagentbenchcontext-filesinference-costdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/should-ai-shopping-agents-pay-micro-transactions-for-verified-product-data/https://groundy.com/articles/should-ai-shopping-agents-pay-micro-transactions-for-verified-product-data/A402 binds agent micropayments to verified delivery, but its TEE attests execution rather than product truth, leaving marketplaces to decide who refunds a wrong attribute.Thu, 25 Jun 2026 05:32:50 GMTGroundy Editorial2026-06-25T00:00:00.000Zagentic-commercemicropaymentsa402x402payment-channelstee-attestationGroundy Editorialhttps://groundy.com/articles/meituans-general-365-benchmark-top-models-all-score-under/https://groundy.com/articles/meituans-general-365-benchmark-top-models-all-score-under/Meituan's General 365 benchmark caps Gemini 3 Pro at 62.8% and most of 26 models below 60%, exposing how saturated public leaderboards inflate reasoning scores.Thu, 25 Jun 2026 04:38:18 GMTGroundy Editorial2026-06-25T00:00:00.000Zai-benchmarksreasoningllm-evaluationdata-contaminationgeneral-365meituanGroundy Editorialhttps://groundy.com/articles/llm-surrogates-in-a-b-tests-the-39-recovery-gap-and-the-silent-bias-risk/https://groundy.com/articles/llm-surrogates-in-a-b-tests-the-39-recovery-gap-and-the-silent-bias-risk/A 2026 preprint proposes LLMs as A/B test proxies for human subjects. Raw outputs captured 39% of the treatment effect, and surrogacy bias does not average out.Thu, 25 Jun 2026 03:34:01 GMTGroundy Editorial2026-06-25T00:00:00.000Zab-testingsurrogate-endpointsllm-evaluationcausal-inferencesynthetic-usersstatistical-biasGroundy Editorialhttps://groundy.com/articles/llm-token-pricing-vs-compute-cost-what-the-tokenomics-math-shows/https://groundy.com/articles/llm-token-pricing-vs-compute-cost-what-the-tokenomics-math-shows/Token pricing decouples from GPU cost via cached discounts, reasoning markups, and per-model multipliers. No single per-token rate works as a budget unit for real workloads.Thu, 25 Jun 2026 02:48:03 GMTGroundy Editorial2026-06-25T00:00:00.000Zllm-pricingtokenomicsinference-costgithub-copilotreasoning-tokenscache-discountscapacity-planningGroundy Editorialhttps://groundy.com/articles/do-llm-judges-favor-their-own-output-a-sanity-check-on-self-preference/https://groundy.com/articles/do-llm-judges-favor-their-own-output-a-sanity-check-on-self-preference/An LLM judge's self-preference claim holds only if the study fixed generation quality. Without that control, the bias number conflates real preference with a quality gap.Thu, 25 Jun 2026 00:20:07 GMTGroundy Editorial2026-06-25T00:00:00.000Zllm-as-judgeself-preferenceeval-methodologyrlhfai-benchmarkspreference-dataGroundy Editorialhttps://groundy.com/articles/can-a-conversational-graph-compile-into-a-goal-oriented-dialogue-runtime/https://groundy.com/articles/can-a-conversational-graph-compile-into-a-goal-oriented-dialogue-runtime/A June 2026 paper proposes the Goal-Oriented Dialogue Runtime, lifting goals, lifecycle state, and invalidation rules into first-class objects teams can version and diff.Wed, 24 Jun 2026 23:51:15 GMTGroundy Editorial2026-06-24T00:00:00.000Zgoal-oriented-dialoguedialogue-managementagent-orchestrationmulti-agent-systemsagent-frameworksllm-agentsconversational-aiGroundy Editorialhttps://groundy.com/articles/auto-reproducing-text-to-image-jailbreaks-from-papers-the-pixjail-pipeline/https://groundy.com/articles/auto-reproducing-text-to-image-jailbreaks-from-papers-the-pixjail-pipeline/PixJail converts text-to-image jailbreak papers into runnable pipelines, reproducing eleven methods with 2.1% error, a fidelity figure, not a real bypass rate.Wed, 24 Jun 2026 23:33:05 GMTGroundy Editorial2026-06-24T00:00:00.000Zt2i-jailbreakai-safetycontent-filteringred-teamingreproducibilityadversarial-attacksGroundy Editorialhttps://groundy.com/articles/can-a-cryptographic-certificate-prove-an-ai-agents-output-is-valid/https://groundy.com/articles/can-a-cryptographic-certificate-prove-an-ai-agents-output-is-valid/A certificate can prove an agent output is signed and intact, but not correct. Validity needs a checkable predicate a verifier can re-run, not all tasks have one.Wed, 24 Jun 2026 22:53:35 GMTGroundy Editorial2026-06-24T00:00:00.000Zoutput-verificationai-agentscryptographyattestationllm-as-judgeformal-verificationGroundy Editorialhttps://groundy.com/articles/vercel-on-the-aws-marketplace-what-the-listing-does-to-procurement-and-lock/https://groundy.com/articles/vercel-on-the-aws-marketplace-what-the-listing-does-to-procurement-and-lock/Vercel has been on the AWS Marketplace since 2024. The real shift is that an EDP commit can absorb the spend, coupling the frontend host to AWS and deepening the lock-in.Wed, 24 Jun 2026 22:08:15 GMTGroundy Editorial2026-06-24T00:00:00.000Zaws-marketplacevercelcommitted-spendvendor-lock-inprocurementawsGroundy Editorialhttps://groundy.com/articles/machine-readable-ai-usage-terms-does-odrls-permission-model-hold/https://groundy.com/articles/machine-readable-ai-usage-terms-does-odrls-permission-model-hold/A June 2026 preprint grounds ODRL's permissions and prohibitions in the UFO-L legal ontology, naming who holds the power to declare a violation in vendor AI usage policies.Wed, 24 Jun 2026 21:48:21 GMTGroundy Editorial2026-06-24T00:00:00.000Zodrlai-usage-policymachine-readable-rightslegal-ontologyufo-lrights-encodingGroundy Editorialhttps://groundy.com/articles/crewai-vs-autogen-vs-microsoft-agent-framework-autogens-merger-reframes/https://groundy.com/articles/crewai-vs-autogen-vs-microsoft-agent-framework-autogens-merger-reframes/Microsoft merged AutoGen into Agent Framework, leaving CrewAI versus MAF as the 2026 choice. The orchestration primitive you pick becomes your trace and policy boundary.Wed, 24 Jun 2026 20:49:15 GMTGroundy Editorial2026-06-24T00:00:00.000Zmicrosoft-agent-frameworkcrewaiautogenmulti-agent-frameworksagent-orchestrationlanggraphagent-governanceGroundy Editorialhttps://groundy.com/articles/vercel-now-deploys-long-running-node-servers-the-serverless-boundary-shifts/https://groundy.com/articles/vercel-now-deploys-long-running-node-servers-the-serverless-boundary-shifts/Vercel's 23 June Node server deploy caps a cluster of duration and transport raises that pull realtime workloads back into one Fluid Compute envelope, raising lock-in stakes.Wed, 24 Jun 2026 19:00:34 GMTGroundy Editorial2026-06-24T00:00:00.000Zvercelserverlessfluid-computenode-jswebsocketscloud-infrastructureplatform-engineeringGroundy Editorialhttps://groundy.com/articles/who-audits-the-safety-rules-an-llm-agent-evolves-for-itself/https://groundy.com/articles/who-audits-the-safety-rules-an-llm-agent-evolves-for-itself/AutoSpec grows LLM agent safety rules from annotated traces and hits 0.98 F1, but readable rules do not prove the rule set is complete. That is the open governance question.Wed, 24 Jun 2026 18:46:14 GMTGroundy Editorial2026-06-24T00:00:00.000Zagent-safetyllm-agentsai-governanceguardrailsinductive-logic-programmingsafety-rulesGroundy Editorialhttps://groundy.com/articles/can-you-trust-an-llm-judge-to-grade-an-agentic-data-analysis-system/https://groundy.com/articles/can-you-trust-an-llm-judge-to-grade-an-agentic-data-analysis-system/A cascade grader for agentic data analysis hit 100% precision and 97% recall on 153 tasks, but silently returned no verdict on 64% of runs before a nudge fix.Wed, 24 Jun 2026 18:20:14 GMTGroundy Editorial2026-06-24T00:00:00.000Zllm-as-judgeagent-evaluationagentic-systemsautomated-gradingdata-analysis-agentseval-pipelinesGroundy Editorialhttps://groundy.com/articles/do-llm-agent-societies-develop-their-own-authority-hierarchies/https://groundy.com/articles/do-llm-agent-societies-develop-their-own-authority-hierarchies/A June 2026 preprint shows LLM agent societies spontaneously form authority hierarchies, so the orchestration topology you specify is not the only coordination layer running.Wed, 24 Jun 2026 17:59:59 GMTGroundy Editorial2026-06-24T00:00:00.000Zmulti-agent-systemsllm-agentscoordination-protocolsemergent-behaviormulti-agent-evaluationagent-societiesGroundy Editorialhttps://groundy.com/articles/serving-cold-moe-models-crosspool-disaggregates-kv-cache-and-weights/https://groundy.com/articles/serving-cold-moe-models-crosspool-disaggregates-kv-cache-and-weights/CrossPool splits MoE FFN weights and KV-cache into separate GPU pools and ships hidden states across the boundary, trading VRAM residency for an interconnect bottleneck.Wed, 24 Jun 2026 17:43:23 GMTGroundy Editorial2026-06-24T00:00:00.000Zmoe-servingkv-cachemodel-disaggregationgpu-memoryinference-infrastructuremulti-tenant-servingGroundy Editorialhttps://groundy.com/articles/vercel-botids-telemetry-is-a-threat-intelligence-feed-most-teams-discard/https://groundy.com/articles/vercel-botids-telemetry-is-a-threat-intelligence-feed-most-teams-discard/Vercel BotID emits session telemetry, verdicts, JA4 digests, paths, and verified-bot labels, rich enough to repurpose as a threat feed and flag what the WAF lets through.Wed, 24 Jun 2026 14:33:37 GMTGroundy Editorial2026-06-24T00:00:00.000Zbot-detectionvercel-botidthreat-intelligencewafbot-fingerprintingcdn-securitysiemGroundy Editorialhttps://groundy.com/articles/when-vibe-coded-software-is-safety-critical-who-verifies/https://groundy.com/articles/when-vibe-coded-software-is-safety-critical-who-verifies/A June 2026 preprint argues vibe-coded code cannot certify under aviation or automotive safety standards, shifting the audit object from prompt to verification artifact.Wed, 24 Jun 2026 14:11:33 GMTGroundy Editorial2026-06-24T00:00:00.000Zvibe-codingformal-verificationai-code-generationsafety-criticalmodel-driven-engineeringsoftware-certificationGroundy Editorialhttps://groundy.com/articles/extracting-unseen-training-data-from-an-llm-by-poisoning-its-loss-landscape/https://groundy.com/articles/extracting-unseen-training-data-from-an-llm-by-poisoning-its-loss-landscape/Loss landscape poisoning reshapes a model's loss function so that ordinary training forces it to memorize a record the attacker never possessed, lifting extraction to 100%.Wed, 24 Jun 2026 13:33:02 GMTGroundy Editorial2026-06-24T00:00:00.000Zdata-poisoningtraining-data-extractionllm-securitydifferential-privacyfederated-learningfine-tuningGroundy Editorialhttps://groundy.com/articles/do-retrieval-metrics-predict-tool-use-agent-success-a-paper-says/https://groundy.com/articles/do-retrieval-metrics-predict-tool-use-agent-success-a-paper-says/A June 2026 arXiv paper shows recall@k misleads when evaluating RAG-backed agents: on tau-bench, 7% rank-1 recall still produced near-gold policy classification.Wed, 24 Jun 2026 13:06:33 GMTGroundy Editorial2026-06-24T00:00:00.000Zragagent-evaluationretrieval-evaluationtool-use-agentstau-benchllm-metricsGroundy Editorialhttps://groundy.com/articles/vercels-in-function-concurrency-what-it-does-to-cold-starts-and-billing/https://groundy.com/articles/vercels-in-function-concurrency-what-it-does-to-cold-starts-and-billing/Vercel's in-function concurrency lets one warm instance serve many requests. Cold starts and idle-I/O bills drop, but CPU-bound handlers contend and shared state can race.Wed, 24 Jun 2026 12:32:59 GMTGroundy Editorial2026-06-24T00:00:00.000Zfluid-computeserverlessvercelcold-startsserverless-billingin-function-concurrencyGroundy Editorialhttps://groundy.com/articles/can-you-trust-an-ai-robustness-certificate-a-paper-says-verify/https://groundy.com/articles/can-you-trust-an-ai-robustness-certificate-a-paper-says-verify/A June 2026 preprint sharpens how neural-network robustness certificates are computed, but verifiers that issue them can return wrong verdicts and miss planted backdoors.Wed, 24 Jun 2026 11:41:30 GMTGroundy Editorial2026-06-24T00:00:00.000Zrobustness-certificationneural-network-verificationadversarial-examplesformal-verificationai-safetyfloating-pointGroundy Editorialhttps://groundy.com/articles/can-you-pinpoint-which-step-broke-a-long-horizon-ai-agent/https://groundy.com/articles/can-you-pinpoint-which-step-broke-a-long-horizon-ai-agent/SAFARI probes long agent runs to localize the failing step, beating prior methods by 20% and shifting triage cost from engineer hours to inference spend.Wed, 24 Jun 2026 11:11:22 GMTGroundy Editorial2026-06-24T00:00:00.000Zagent-fault-attributionlong-horizon-agentsagent-debuggingllm-agentstrace-analysisinference-costGroundy Editorialhttps://groundy.com/articles/vercels-series-d-thesis-hardened-into-a-whole-stack-lock/https://groundy.com/articles/vercels-series-d-thesis-hardened-into-a-whole-stack-lock/Vercel's 2021 Series D stated a whole-lifecycle platform thesis. Later rounds financed acquisitions that moved lock-in past hosting into analytics, CI, runtime, and agents.Wed, 24 Jun 2026 10:17:25 GMTGroundy Editorial2026-06-24T00:00:00.000Zvercelvendor-lock-inplatform-consolidationnextjsagentic-infrastructureacquisitionsGroundy Editorialhttps://groundy.com/articles/make-look-scanned-simulates-scans-in-an-offline-wasm-file-exposing-pdf/https://groundy.com/articles/make-look-scanned-simulates-scans-in-an-offline-wasm-file-exposing-pdf/make-look-scanned runs scan simulation in an offline 8 MB WASM file: skew, grain, JPEG artifacts, zero uploads. Scan appearance is no longer a proxy for physical provenance.Wed, 24 Jun 2026 09:36:30 GMTGroundy Editorial2026-06-24T00:00:00.000Zwasmpdf-toolsscan-simulationdocument-securityclient-sidegoGroundy Editorialhttps://groundy.com/articles/poisoning-a-rag-retriever-how-conflict-aware-edits-inject-false-knowledge/https://groundy.com/articles/poisoning-a-rag-retriever-how-conflict-aware-edits-inject-false-knowledge/CAREATTACK (June 2026) edits RAG retriever weights to surface attacker-chosen passages, bypassing corpus defenses and moving the trust boundary onto the embedding model.Wed, 24 Jun 2026 06:54:47 GMTGroundy Editorial2026-06-24T00:00:00.000Zrag-securityembedding-modelsllm-securitysupply-chain-securityretriever-poisoningmodel-editingGroundy Editorialhttps://groundy.com/articles/can-ai-write-cad-programs-cadbench-measures-the-gap/https://groundy.com/articles/can-ai-write-cad-programs-cadbench-measures-the-gap/CADBench evaluates eleven systems on 18,000 CAD samples and finds vision-language models unreliable, a gap SWE-bench and LiveCodeBench were never built to measure.Wed, 24 Jun 2026 05:58:02 GMTGroundy Editorial2026-06-24T00:00:00.000Zcadbenchmarksvision-language-modelsprogram-synthesismultimodal-modelsmechanical-designGroundy Editorialhttps://groundy.com/articles/vercel-raised-its-cdn-origin-timeout-to-two-minutes-what-breaks-first/https://groundy.com/articles/vercel-raised-its-cdn-origin-timeout-to-two-minutes-what-breaks-first/Vercel lifted its CDN origin timeout from 30 to 120 seconds, relocating rather than removing a failure boundary and holding wedged connections four times longer before a 504.Wed, 24 Jun 2026 05:16:28 GMTGroundy Editorial2026-06-24T00:00:00.000Zvercelcdntimeoutsserverlessllm-streamingedge-functionsGroundy Editorialhttps://groundy.com/articles/gradio-lite-runs-model-inference-in-the-browser-via-pyodide-no-server/https://groundy.com/articles/gradio-lite-runs-model-inference-in-the-browser-via-pyodide-no-server/Gradio-Lite runs the Gradio Python runtime as WebAssembly via Pyodide, pushing inference into the visitor's browser with no server, bounded by CPU compute and browser memory.Wed, 24 Jun 2026 04:25:12 GMTGroundy Editorial2026-06-24T00:00:00.000Zgradio-litepyodidewebassemblybrowser-inferenceclient-side-aiinference-costGroundy Editorialhttps://groundy.com/articles/vercels-billing-usage-api-wiring-cost-data-into-ci-cost-gates/https://groundy.com/articles/vercels-billing-usage-api-wiring-cost-data-into-ci-cost-gates/Vercel's /billing/charges API streams FOCUS v1.3 cost data you can wire into a deploy-failing CI gate, but the team-scoped feed cannot name the agent run behind a breach.Wed, 24 Jun 2026 02:07:28 GMTGroundy Editorial2026-06-24T00:00:00.000Zvercelbilling-apifinopscost-gatesci-cdcost-attributionGroundy Editorialhttps://groundy.com/articles/cloudflare-ai-gateway-adds-spend-limits-to-cap-the-runaway-inference-bill/https://groundy.com/articles/cloudflare-ai-gateway-adds-spend-limits-to-cap-the-runaway-inference-bill/Cloudflare AI Gateway spend limits cap dollar spend per rule and return HTTP 429 when exceeded, turning cost control into an inline circuit breaker, not a billing alert.Wed, 24 Jun 2026 01:42:59 GMTGroundy Editorial2026-06-24T00:00:00.000Zai-gatewayspend-limitsinference-costllm-gatewaycost-controlcloudflareGroundy Editorialhttps://groundy.com/articles/vercel-now-honors-stale-if-error-serving-stale-cache-when-the-origin-dies/https://groundy.com/articles/vercel-now-honors-stale-if-error-serving-stale-cache-when-the-origin-dies/Vercel's CDN now serves a cached copy when an origin fails, but only inside the stale-if-error window you set. It masks transient failures, it does not fix the origin.Wed, 24 Jun 2026 01:11:12 GMTGroundy Editorial2026-06-24T00:00:00.000Zvercelstale-if-errorhttp-cachingcache-controlcdnrfc-5861Groundy Editorialhttps://groundy.com/articles/bytedances-doubao-2-1-pro-vs-gpt-5-5-reading-self-reported-benchmarks/https://groundy.com/articles/bytedances-doubao-2-1-pro-vs-gpt-5-5-reading-self-reported-benchmarks/ByteDance's Doubao-Seed-2.1 Pro launch deck claims parity with GPT-5.5 on benchmarks ByteDance graded itself, and no independent source has reproduced the scores yet.Wed, 24 Jun 2026 00:21:31 GMTGroundy Editorial2026-06-24T00:00:00.000Zdoubaobytedanceai-benchmarksmodel-evaluationllm-leaderboardschinese-aiGroundy Editorialhttps://groundy.com/articles/can-a-benchmark-catch-when-ai-discharge-summaries-drop-care-steps/https://groundy.com/articles/can-a-benchmark-catch-when-ai-discharge-summaries-drop-care-steps/CareTransition-Audit scores 11 LLMs on whether AI discharge summaries keep every follow-up and medication step. The best reach moderate clinician agreement, kappa near 0.5.Tue, 23 Jun 2026 23:09:27 GMTGroundy Editorial2026-06-23T00:00:00.000Zllm-evaluationclinical-documentationhealthcare-aidischarge-summaryai-scribebenchmarkGroundy Editorialhttps://groundy.com/articles/vercel-cli-now-scopes-commands-to-the-local-directory-audit-your-ci-scripts/https://groundy.com/articles/vercel-cli-now-scopes-commands-to-the-local-directory-audit-your-ci-scripts/Vercel CLI v50.40.0 scopes read-only commands like vc project ls to the local directory's team, so CI scripts that cd between projects now return different output.Tue, 23 Jun 2026 22:27:49 GMTGroundy Editorial2026-06-23T00:00:00.000Zvercel-clici-cdmonorepoverceldeploymentcli-toolsGroundy Editorialhttps://groundy.com/articles/react-router-cve-2025-31137-vercels-edge-fix-is-not-the-patch/https://groundy.com/articles/react-router-cve-2025-31137-vercels-edge-fix-is-not-the-patch/Vercel's edge mitigation for CVE-2025-31137 covers only traffic on its network. Self-hosted, preview, and non-Vercel Remix deploys still need the adapter patch.Tue, 23 Jun 2026 21:49:48 GMTGroundy Editorial2026-06-23T00:00:00.000Zreact-routerremixvercelcve-2025-31137host-header-injectionexpress-adapterGroundy Editorialhttps://groundy.com/articles/vercels-manual-cdn-purge-api-cache-control-without-a-redeploy/https://groundy.com/articles/vercels-manual-cdn-purge-api-cache-control-without-a-redeploy/Vercel's cache-tag purge API clears CDN, Runtime, and Data cache at runtime, no redeploy. The verb sets origin load: invalidate stays safe, dangerously-delete can stampede.Tue, 23 Jun 2026 20:55:21 GMTGroundy Editorial2026-06-23T00:00:00.000Zcache-purgecdn-cachecache-tagsvercelisrnext-jsGroundy Editorialhttps://groundy.com/articles/samsung-picks-openais-codex-for-its-engineers-pressuring-github-copilot/https://groundy.com/articles/samsung-picks-openais-codex-for-its-engineers-pressuring-github-copilot/Samsung Electronics sanctioned ChatGPT Enterprise and Codex across its Korea and DX workforce, a procurement anchor that tilts enterprise dev-tool defaults away from Copilot.Tue, 23 Jun 2026 20:23:10 GMTGroundy Editorial2026-06-23T00:00:00.000Zcodexopenaigithub-copilotenterprise-aisamsungdeveloper-toolsai-procurementGroundy Editorialhttps://groundy.com/articles/vercel-sandbox-snapshot-retention-what-custom-windows-change-for-agent-runtimes/https://groundy.com/articles/vercel-sandbox-snapshot-retention-what-custom-windows-change-for-agent-runtimes/Vercel Sandbox's custom snapshot retention turns auto-cleanup into an operator decision: keep failure states replayable for agent runs while capping the $0.08/GB-month bill.Tue, 23 Jun 2026 19:27:36 GMTGroundy Editorial2026-06-23T00:00:00.000Zvercel-sandboxsnapshot-retentionagent-runtimesreproducibilitycost-managementdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/potion-so-sold-after-4-000-vercel-deploys-the-micro-saas-exit-playbook/https://groundy.com/articles/potion-so-sold-after-4-000-vercel-deploys-the-micro-saas-exit-playbook/Potion.so sold for $300,000 at 4x ARR because when managed hosting absorbs infrastructure and scaling, only distribution and operations are left to sell.Tue, 23 Jun 2026 17:43:27 GMTGroundy Editorial2026-06-23T00:00:00.000Zmicro-saasacqui-exitsaas-valuationindie-saasnotionvercelGroundy Editorialhttps://groundy.com/articles/do-llm-personality-tests-measure-anything-a-new-paper-says/https://groundy.com/articles/do-llm-personality-tests-measure-anything-a-new-paper-says/A June 2026 arXiv preprint finds 81 to 90 percent of LLM personality test variation stems from directional response bias, undermining persona and safety scores.Tue, 23 Jun 2026 17:16:02 GMTGroundy Editorial2026-06-23T00:00:00.000Zllm-personalitypsychometricsresponse-biasllm-evaluationbenchmark-validityai-safetyGroundy Editorialhttps://groundy.com/articles/reported-react-server-components-leak-is-unconfirmed-audit-the-payload/https://groundy.com/articles/reported-react-server-components-leak-is-unconfirmed-audit-the-payload/A reported React Server Components source-code leak has no CVE or advisory in React or Vercel's channels. Audit what your app serializes before trusting the boundary.Tue, 23 Jun 2026 16:43:34 GMTGroundy Editorial2026-06-27T00:00:00.000Zreact-server-componentsnextjsweb-securityserializationvercelvulnerability-disclosuresource-code-leakGroundy Editorialhttps://groundy.com/articles/generating-vercel-firewall-rules-from-natural-language-what-to-audit/https://groundy.com/articles/generating-vercel-firewall-rules-from-natural-language-what-to-audit/Vercel's natural-language WAF rules silently fill rate-limit defaults and persistent block durations. Read the generated config before publish, not the prompt.Tue, 23 Jun 2026 15:31:57 GMTGroundy Editorial2026-06-23T00:00:00.000Zvercelwaffirewall-rulesrate-limitingsecurity-reviewcli-toolsGroundy Editorialhttps://groundy.com/articles/glm-5-2-coding-plan-vs-claude-opus-4-8-picking-a-model-for-coding-agents/https://groundy.com/articles/glm-5-2-coding-plan-vs-claude-opus-4-8-picking-a-model-for-coding-agents/GLM-5.2 ships an MIT-licensed Coding Plan at $12.6 to $112 per month, forcing coding-agent teams to weigh billing model and license terms over the missing benchmark table.Tue, 23 Jun 2026 15:00:16 GMTGroundy Editorial2026-06-23T00:00:00.000Zcoding-agentsglm-52claude-opusllm-pricingopen-source-llmsself-hostingGroundy Editorialhttps://groundy.com/articles/vercels-secure-ai-agent-guidance-pushes-defense-into-the-sandbox/https://groundy.com/articles/vercels-secure-ai-agent-guidance-pushes-defense-into-the-sandbox/Vercel treats prompt injection and agent hallucination as unsolvable at the model layer, routing defense into per-session sandboxes and shifting security onto deployment ops.Tue, 23 Jun 2026 14:01:34 GMTGroundy Editorial2026-06-23T00:00:00.000Zagent-securityprompt-injectionai-agentssandboxingleast-privilegesecrets-managementGroundy Editorialhttps://groundy.com/articles/nx-supply-chain-attack-used-developers-own-ai-clis-to-hunt-secrets/https://groundy.com/articles/nx-supply-chain-attack-used-developers-own-ai-clis-to-hunt-secrets/s1ngularity's malicious Nx packages invoked installed AI CLIs with permission bypass flags to enumerate secrets, making any local agent a scriptable recon primitive.Tue, 23 Jun 2026 13:46:56 GMTGroundy Editorial2026-06-23T00:00:00.000Zsupply-chain-attacknpmai-cliclaude-codemalwarecredential-theftagent-securityGroundy Editorialhttps://groundy.com/articles/vercel-folds-backends-agent-tooling-and-operations-into-its-deploy-platform/https://groundy.com/articles/vercel-folds-backends-agent-tooling-and-operations-into-its-deploy-platform/At Ship 2026, Vercel launched an agentic infrastructure platform that folds backends, agent tooling, and operations into its deploy stack, raising switching costs.Tue, 23 Jun 2026 12:52:58 GMTGroundy Editorial2026-06-23T00:00:00.000Zvercelagentic-infrastructureagent-platformplatform-consolidationdevopsobservabilityGroundy Editorialhttps://groundy.com/articles/cloudflare-now-routes-public-traffic-to-private-apps-via-dns-no-vpn/https://groundy.com/articles/cloudflare-now-routes-public-traffic-to-private-apps-via-dns-no-vpn/Cloudflare's private-origins DNS routing lets public hostnames reach RFC 1918 apps without a VPN, but the flag only routes traffic; it does not authenticate callers.Tue, 23 Jun 2026 12:24:32 GMTGroundy Editorial2026-06-23T00:00:00.000Zcloudflarednsprivate-networkingnetwork-securityzero-trustvpnGroundy Editorialhttps://groundy.com/articles/openais-patch-the-planet-is-security-capacity-for-nine-projects-not/https://groundy.com/articles/openais-patch-the-planet-is-security-capacity-for-nine-projects-not/OpenAI's Patch the Planet routes AI security research, ChatGPT Pro, and API credits to nine named projects, leaving the maintainer triage economics beneath them untouched.Tue, 23 Jun 2026 11:51:55 GMTGroundy Editorial2026-06-23T00:00:00.000Zopen-sourceopenaimaintainer-burnoutsecuritypatch-the-planetsoftware-supply-chainGroundy Editorialhttps://groundy.com/articles/minimax-m3-claims-gpt-5-5-beating-code-with-1m-context-and-open-weights/https://groundy.com/articles/minimax-m3-claims-gpt-5-5-beating-code-with-1m-context-and-open-weights/MiniMax M3 bundles open weights, a 1M-token context, and multimodal input, and claims a 0.4-point coding edge over GPT-5.5 that nobody has verified.Tue, 23 Jun 2026 10:32:06 GMTGroundy Editorial2026-06-23T00:00:00.000Zminimax-m3open-weight-modelsllm-benchmarkslong-context-llmscoding-agentsmultimodal-modelsGroundy Editorialhttps://groundy.com/articles/george-hotz-says-only-agi-doom-justifies-todays-ai-valuations/https://groundy.com/articles/george-hotz-says-only-agi-doom-justifies-todays-ai-valuations/Hotz argues OpenAI's $500B valuation only closes in a DCF model via an AGI assumption, fusing the safety narrative and investor pitch into a timeline no incumbent can revise.Tue, 23 Jun 2026 08:33:51 GMTGroundy Editorial2026-06-23T00:00:00.000Zai-valuationsopenaiagigeorge-hotzfrontier-aitech-investmentipoGroundy Editorialhttps://groundy.com/articles/githubs-ai-capacity-crunch-pushes-microsoft-to-rent-aws-compute/https://groundy.com/articles/githubs-ai-capacity-crunch-pushes-microsoft-to-rent-aws-compute/Microsoft reportedly rents AWS compute to keep GitHub's AI inference running after Azure fell behind, signaling that owned infrastructure no longer self-supplies AI load.Tue, 23 Jun 2026 04:51:55 GMTGroundy Editorial2026-06-23T00:00:00.000Zmulti-cloudai-inferencegithubazurecloud-capacityhyperscalersGroundy Editorialhttps://groundy.com/articles/community-lora-mining-raises-a-consent-gap-for-style-generation/https://groundy.com/articles/community-lora-mining-raises-a-consent-gap-for-style-generation/FreeStyle, a June 2026 preprint, mines community LoRA adapters as training data for image generation, shifting licensing burden onto contributors and platforms like Civitai.Tue, 23 Jun 2026 04:33:08 GMTGroundy Editorial2026-06-23T00:00:00.000Zlora-adaptersimage-generationai-licensingmodel-governancecivitaiai-ethicsopen-weightsGroundy Editorialhttps://groundy.com/articles/why-audio-deepfake-detectors-keep-losing-the-voice-cloning-arms-race/https://groundy.com/articles/why-audio-deepfake-detectors-keep-losing-the-voice-cloning-arms-race/A 34,000-parameter audio deepfake detector reaches only 75 to 80 percent cross-domain accuracy, a result that shows why post-hoc detection sits downstream of generation.Mon, 22 Jun 2026 00:07:30 GMTGroundy Editorial2026-06-22T00:00:00.000Zdeepfake-detectionaudio-deepfakesvoice-cloningc2pacontent-provenancemachine-learningGroundy Editorialhttps://groundy.com/articles/mixed-compliance-data-makes-safety-fine-tuning-a-curation-problem/https://groundy.com/articles/mixed-compliance-data-makes-safety-fine-tuning-a-curation-problem/A June 2026 preprint shows benign and harmful compliance examples are not interchangeable, with DPO, not SFT, the stage that stops benign examples from amplifying harm.Sun, 21 Jun 2026 23:40:44 GMTGroundy Editorial2026-06-21T00:00:00.000Zllm-safetyjailbreakingsafety-alignmentdirect-preference-optimizationfine-tuningai-alignmentGroundy Editorialhttps://groundy.com/articles/when-an-llm-narrates-a-solver-the-explanation-drifts-from-the-math/https://groundy.com/articles/when-an-llm-narrates-a-solver-the-explanation-drifts-from-the-math/A June 2026 arXiv paper isolates the narration gap in LLM-solver loops: prompt injection can invert a verified verdict at the prose stage, breaking reasoning-log audits.Sun, 21 Jun 2026 23:01:20 GMTGroundy Editorial2026-06-21T00:00:00.000Zllm-agentsprompt-injectionformal-verificationneuro-symbolic-aiai-compliancechain-of-thoughtGroundy Editorialhttps://groundy.com/articles/cloudflares-temporary-accounts-give-ai-agents-disposable-credentials/https://groundy.com/articles/cloudflares-temporary-accounts-give-ai-agents-disposable-credentials/Cloudflare's temporary accounts give agents auto-expiring 60-minute credentials, but the launch is an onboarding shortcut, not a scoped security control.Sun, 21 Jun 2026 22:33:09 GMTGroundy Editorial2026-06-21T00:00:00.000Zcloudflareai-agentscloud-securityapi-credentialsephemeral-credentialsserverlesszero-trustGroundy Editorialhttps://groundy.com/articles/grading-diffusiongemma-how-an-open-weight-diffusion-model-scores-on-transparency/https://groundy.com/articles/grading-diffusiongemma-how-an-open-weight-diffusion-model-scores-on-transparency/An arXiv paper finds DiffusionGemma's opaque serial depth collapses from 28.6x to 1.1x via a token bottleneck, though its model card leaves training data unitemized.Sun, 21 Jun 2026 22:10:25 GMTGroundy Editorial2026-06-21T00:00:00.000Zai-transparencymodel-interpretabilitydiffusion-modelsopen-weightsmodel-cardsgemmaGroundy Editorialhttps://groundy.com/articles/who-owns-editorial-authority-when-llms-mediate-knowledge/https://groundy.com/articles/who-owns-editorial-authority-when-llms-mediate-knowledge/A June 2026 preprint argues no role in the LLM pipeline holds editorial sign-off for what answer engines surface as public knowledge, framing it as a governance gap.Sun, 21 Jun 2026 21:36:40 GMTGroundy Editorial2026-06-21T00:00:00.000Zai-governanceeditorial-alignmentllm-alignmentanswer-enginesragai-ethicsknowledge-managementGroundy Editorialhttps://groundy.com/articles/lithuanias-open-source-drone-detection-network-signals-an-air-defense-shift/https://groundy.com/articles/lithuanias-open-source-drone-detection-network-signals-an-air-defense-shift/A Lithuanian open-source drone-detection network points to cheap passive sensor meshes that could move air defense off centralized radar, though unvalidated by field tests.Sun, 21 Jun 2026 21:02:35 GMTGroundy Editorial2026-06-21T00:00:00.000Zcounter-droneopen-sourceair-defensedrone-detectionacoustic-sensorssensor-networkslithuaniaGroundy Editorialhttps://groundy.com/articles/why-ai-misreads-nigerian-english-a-register-gap-in-public-discourse/https://groundy.com/articles/why-ai-misreads-nigerian-english-a-register-gap-in-public-discourse/Models tuned on standard English misread Nigerian English and Pidgin register shifts, pushing intent validation onto local annotators vendors rarely fund.Sun, 21 Jun 2026 20:40:47 GMTGroundy Editorial2026-06-21T00:00:00.000Znigerian-englishnlp-biassentiment-analysiscontent-moderationcode-switchingafrican-nlplocal-annotationGroundy Editorialhttps://groundy.com/articles/deep-research-benchmarks-hide-how-agents-fail-at-open-web-source-grounding/https://groundy.com/articles/deep-research-benchmarks-hide-how-agents-fail-at-open-web-source-grounding/June 2026 benchmarks like DRFLOW show agents that ace curated RAG retrieval still fail to ground primary sources in the open web, leaving citation audits to humans.Sun, 21 Jun 2026 19:59:38 GMTGroundy Editorial2026-06-21T00:00:00.000Zagentic-searchragbenchmarksdeep-researchllm-agentsai-evaluationsource-groundingGroundy Editorialhttps://groundy.com/articles/vector-database-access-control-is-missing-and-rag-pipelines-pay/https://groundy.com/articles/vector-database-access-control-is-missing-and-rag-pipelines-pay/Production vector databases enforce access control at the collection boundary, not per embedding, so RAG retrieval can leak chunks a user's row-level policy blocked.Sun, 21 Jun 2026 19:43:28 GMTGroundy Editorial2026-06-21T00:00:00.000Zragvector-databasesaccess-controldatabase-securityfine-grained-access-controldata-governanceenterprise-aiGroundy Editorialhttps://groundy.com/articles/dspy-ships-autonomous-prompt-optimization-but-judge-drift-is-the-failure-mode/https://groundy.com/articles/dspy-ships-autonomous-prompt-optimization-but-judge-drift-is-the-failure-mode/DSPy's GEPA optimizer already tunes LLM prompts with no human in the loop, but judge drift and trajectory collapse are the failure modes when the metric is wrong.Sun, 21 Jun 2026 19:17:03 GMTGroundy Editorial2026-06-21T00:00:00.000Zprompt-optimizationdspyllm-pipelinesllm-evaluationhuman-in-the-loopprompt-engineeringGroundy Editorialhttps://groundy.com/articles/what-youtubes-coding-tutorials-teach-about-who-belongs-in-software/https://groundy.com/articles/what-youtubes-coding-tutorials-teach-about-who-belongs-in-software/A June 2026 arXiv preprint argues YouTube software-engineering tutorials encode masculine defaults, shaping who self-selects into the field before any hiring screen.Sun, 21 Jun 2026 18:55:11 GMTGroundy Editorial2026-06-21T00:00:00.000Zsoftware-engineeringyoutube-tutorialsgender-representationcritical-discourse-analysisarxiv-preprintdeveloper-educationGroundy Editorialhttps://groundy.com/articles/finance-agent-benchmarks-expose-where-lending-automation-breaks/https://groundy.com/articles/finance-agent-benchmarks-expose-where-lending-automation-breaks/Vertical finance benchmarks show agents break on chained calculations, and accuracy fails independently of data-handling safety. Lenders must require audit-shaped evidence.Sun, 21 Jun 2026 18:08:13 GMTGroundy Editorial2026-06-21T00:00:00.000Zai-agentsagent-benchmarksllm-evaluationmortgage-originationlending-compliancefinance-aiunderwritingGroundy Editorialhttps://groundy.com/articles/nlnets-grant-model-diverges-from-vc-backed-open-source/https://groundy.com/articles/nlnets-grant-model-diverges-from-vc-backed-open-source/NLnet funds open-source infrastructure through equity-free grants from a 1997 endowment, a model that sidesteps venture capital but depends on EU programme continuity.Sun, 21 Jun 2026 17:41:25 GMTGroundy Editorial2026-06-21T00:00:00.000Zopen-sourcenlnetopen-source-fundingventure-capitaleu-ngigrantsinfrastructureGroundy Editorialhttps://groundy.com/articles/adams-open-source-ai-cad-claim-lacks-a-confirmed-repo-or-accuracy-benchmark/https://groundy.com/articles/adams-open-source-ai-cad-claim-lacks-a-confirmed-repo-or-accuracy-benchmark/Adam's YC-backed Text-to-CAD tool markets itself as open-source AI CAD, but no source confirms a repo or license, and its accuracy on engineering geometry stays unproven.Sun, 21 Jun 2026 17:21:53 GMTGroundy Editorial2026-06-21T00:00:00.000Ztext-to-cadai-cadparametric-modelingautodeskgenerative-designcad-softwareGroundy Editorialhttps://groundy.com/articles/do-ai-agents-reach-for-over-privileged-tools-when-simpler-ones-suffice/https://groundy.com/articles/do-ai-agents-reach-for-over-privileged-tools-when-simpler-ones-suffice/A June 2026 benchmark finds LLM agents routinely pick higher-privilege tools when lower-privilege ones suffice, so least privilege must be enforced at the runtime sandbox.Sun, 21 Jun 2026 16:44:19 GMTGroundy Editorial2026-06-21T00:00:00.000Zleast-privilegellm-agentsagent-securityprivilege-escalationtool-selectionruntime-sandboxingGroundy Editorialhttps://groundy.com/articles/when-should-multi-agent-systems-use-an-event-bus-instead-of-an-orchestrator/https://groundy.com/articles/when-should-multi-agent-systems-use-an-event-bus-instead-of-an-orchestrator/Three June 2026 arXiv preprints move multi-agent coordination off central orchestrators onto event logs and shared state, shifting the bottleneck to ordering and trust.Sun, 21 Jun 2026 16:17:16 GMTGroundy Editorial2026-06-21T00:00:00.000Zmulti-agent-systemsevent-driven-architectureorchestrationagent-coordinationdistributed-systemsllm-frameworksGroundy Editorialhttps://groundy.com/articles/epic-open-sources-lore-a-vcs-pitched-at-gits-scaling-ceiling/https://groundy.com/articles/epic-open-sources-lore-a-vcs-pitched-at-gits-scaling-ceiling/Epic open-sourced Lore, a version control system pitched at the scaling ceiling where Git's object model strains. Operators should demand benchmarks before any migration.Sun, 21 Jun 2026 12:10:29 GMTGroundy Editorial2026-06-21T00:00:00.000Zversion-controlgitlore-vcsgit-lfsperforcemonorepoepic-gamesGroundy Editorialhttps://groundy.com/articles/running-long-context-agents-on-a-4-bit-kv-cache-where-accuracy-breaks/https://groundy.com/articles/running-long-context-agents-on-a-4-bit-kv-cache-where-accuracy-breaks/UltraQuant cuts agent time-to-first-token 3.47x with 4-bit KV caching on AMD CDNA4, but its June 2026 preprint omits the accuracy numbers operators need to ship it.Sun, 21 Jun 2026 10:33:22 GMTGroundy Editorial2026-06-21T00:00:00.000Zkv-cachequantizationinferencellm-servingagentsamd-cdna4Groundy Editorialhttps://groundy.com/articles/defending-agentic-ai-with-deception-misdirecting-model-guided-attacks/https://groundy.com/articles/defending-agentic-ai-with-deception-misdirecting-model-guided-attacks/A preprint shows defensive misdirection can cut estimated attacker-success bounds by up to two orders of magnitude, but leaves the cost to legitimate tasks unmeasured.Sun, 21 Jun 2026 07:31:29 GMTGroundy Editorial2026-06-21T00:00:00.000Zagentic-securityjailbreak-defenseai-deceptionllm-securityred-teamingmodel-guided-attacksGroundy Editorialhttps://groundy.com/articles/the-autonomy-tax-why-rl-rewards-the-wrong-behavior-in-agents/https://groundy.com/articles/the-autonomy-tax-why-rl-rewards-the-wrong-behavior-in-agents/Two June 2026 preprints find RL training in LLM agents rewards the wrong behavior, widening the safety gap and inflating SWE-bench scores by 14 points.Sun, 21 Jun 2026 07:13:56 GMTGroundy Editorial2026-06-21T00:00:00.000Zreward-hackingreinforcement-learningllm-agentsagent-safetyswe-benchai-evaluationproxy-rewardGroundy Editorialhttps://groundy.com/articles/anthropics-procurement-risk-is-policy-refusal-not-jailbreaks/https://groundy.com/articles/anthropics-procurement-risk-is-policy-refusal-not-jailbreaks/Anthropic's record splits AI procurement risk in two: model behavior on benign prompts versus vendor refusal. Both block deployments but need different diligence.Sun, 21 Jun 2026 05:52:46 GMTGroundy Editorial2026-06-21T00:00:00.000Zai-procurementai-safetyfrontier-modelsanthropiccapability-evalsai-governancered-teamingGroundy Editorialhttps://groundy.com/articles/can-you-predict-a-fine-tunes-payoff-before-training-finishes/https://groundy.com/articles/can-you-predict-a-fine-tunes-payoff-before-training-finishes/TuneAhead forecasts fine-tuning success from a short simulated probe, catching 89.4% of winners and 91.0% of failures on Qwen2.5-7B-Instruct for 58.4% compute savings.Sat, 20 Jun 2026 19:06:44 GMTGroundy Editorial2026-06-20T00:00:00.000Zfine-tuningllm-trainingcompute-optimizationmodel-evaluationperformance-predictiongpu-costGroundy Editorialhttps://groundy.com/articles/when-an-algorithm-sequences-gig-hiring-whose-objective-does-it-optimize/https://groundy.com/articles/when-an-algorithm-sequences-gig-hiring-whose-objective-does-it-optimize/A June 2026 preprint makes the employer profit objective in gig hiring explicit, surfacing how optimized dispatch can shift timing risk onto contingent workers.Sat, 20 Jun 2026 18:16:04 GMTGroundy Editorial2026-06-20T00:00:00.000Zgig-economycontingent-laboralgorithmic-hiringmulti-armed-banditoperations-researchlabor-economicsGroundy Editorialhttps://groundy.com/articles/when-llm-generated-cuda-kernels-pass-tests-but-get-the-math-wrong/https://groundy.com/articles/when-llm-generated-cuda-kernels-pass-tests-but-get-the-math-wrong/LLM-written CUDA kernels compile, run, and pass smoke tests while returning wrong numerics, so crash-free execution is not enough to trust AI-generated GPU code.Sat, 20 Jun 2026 17:58:22 GMTGroundy Editorial2026-06-20T00:00:00.000Zcudallm-code-generationgpu-kernelsnumerical-correctnesskernel-validationkernel-benchmarksGroundy Editorialhttps://groundy.com/articles/can-robossms-state-space-backbone-replace-transformer-imitation-policies/https://groundy.com/articles/can-robossms-state-space-backbone-replace-transformer-imitation-policies/The RoboSSM preprint swaps the transformer backbone of in-context robot imitation for a Longhorn state-space model and claims LIBERO gains. The full paper is still pending.Sat, 20 Jun 2026 17:41:53 GMTGroundy Editorial2026-06-20T00:00:00.000Zstate-space-modelsrobot-imitation-learningin-context-learningtransformerssequence-modelingrobot-policiesGroundy Editorialhttps://groundy.com/articles/pruning-experts-to-shrink-moe-models-does-attribution-guided-compression-beat/https://groundy.com/articles/pruning-experts-to-shrink-moe-models-does-attribution-guided-compression-beat/Routing architecture decides whether MoE experts can be pruned safely: hard routers keep calibration per expert, soft routers need an aggregate guard.Sat, 20 Jun 2026 17:26:24 GMTGroundy Editorial2026-06-20T00:00:00.000Zmixture-of-expertsmodel-pruningmodel-calibrationexpert-routingmodel-compressionattributionGroundy Editorialhttps://groundy.com/articles/can-deontic-policy-rules-govern-an-ai-agent-at-runtime/https://groundy.com/articles/can-deontic-policy-rules-govern-an-ai-agent-at-runtime/A June 2026 arXiv paper encodes agent obligations and prohibitions as deontic policies enforced by a logic engine outside the LLM, producing a record auditors can inspect.Sat, 20 Jun 2026 16:37:22 GMTGroundy Editorial2026-06-20T00:00:00.000Zagent-governancedeontic-logicpolicy-enforcementagentic-aiai-compliancepolicy-engineseu-ai-actGroundy Editorialhttps://groundy.com/articles/glm-5-2-vs-kimi-k2-7-code-two-open-weight-bets-on-agentic-coding/https://groundy.com/articles/glm-5-2-vs-kimi-k2-7-code-two-open-weight-bets-on-agentic-coding/GLM-5.2 and Kimi K2.7 Code shipped a day apart as open-weight coding models. One leads every open-weight leaderboard; the other is cheaper and more token-efficient.Sat, 20 Jun 2026 15:30:00 GMTGroundy Editorial2026-06-20T00:00:00.000Zglm-5-2kimi-k2-7open-weightscoding-agentsmodel-comparisonchinese-aimoe-architectureGroundy Editorialhttps://groundy.com/articles/how-linear-is-a-transformer-feed-forward-block-a-new-test-says-its-learned-not/https://groundy.com/articles/how-linear-is-a-transformer-feed-forward-block-a-new-test-says-its-learned-not/Per-block linear recoverability in transformer FFNs swings from near-linear to strongly nonlinear between layers, so compression tools must probe each block per checkpoint.Sat, 20 Jun 2026 09:53:05 GMTGroundy Editorial2026-06-20T00:00:00.000Zlinear-recoverabilitytransformer-ffnmodel-compressionquantizationpruningmechanistic-interpretabilityGroundy Editorialhttps://groundy.com/articles/cursor-goes-to-spacex-windsurf-to-cognition-what-changes-for-dev-teams/https://groundy.com/articles/cursor-goes-to-spacex-windsurf-to-cognition-what-changes-for-dev-teams/Cursor is being acquired by SpaceX for $60B. Windsurf was absorbed into Cognition and rebranded Devin Desktop on June 2. Both vendors have changed; the tools have too.Sat, 20 Jun 2026 07:00:00 GMTGroundy Editorial2026-06-20T00:00:00.000Zcursorwindsurfdevinspacexcognitionai-coding-toolsvendor-lock-inGroundy Editorialhttps://groundy.com/articles/ai-essay-grading-what-a-probe-of-llm-internals-reveals-about-scoring/https://groundy.com/articles/ai-essay-grading-what-a-probe-of-llm-internals-reveals-about-scoring/A June 2026 preprint finds essay quality is linearly decodable from LLM internals, but cannot show whether that signal tracks argument quality or just length and fluency.Fri, 19 Jun 2026 20:06:17 GMTGroundy Editorial2026-06-19T00:00:00.000Zautomated-essay-scoringllm-interpretabilitymechanistic-interpretabilitylinear-probingconstruct-validityed-techGroundy Editorialhttps://groundy.com/articles/glm-5-2-benchmarks-what-62-1-swe-bench-pro-and-99-2-aime-actually-mean/https://groundy.com/articles/glm-5-2-benchmarks-what-62-1-swe-bench-pro-and-99-2-aime-actually-mean/Zhipu published a full benchmark suite for GLM-5.2 on June 19, 2026. Each score targets a different skill domain, and each carries distinct contamination or harness caveats.Fri, 19 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-19T00:00:00.000Zbenchmarksopen-source-llmcoding-agentszhipullm-evaluationswe-benchaimeGroundy Editorialhttps://groundy.com/articles/glm-5-2-mit-weights-vs-llama-license-self-hosting-compliance-for-regulated/https://groundy.com/articles/glm-5-2-mit-weights-vs-llama-license-self-hosting-compliance-for-regulated/GLM-5.2 ships under MIT, removing the Llama usage-threshold audit burden, but finance and healthcare teams still face compliance gaps when self-hosting this 753B MoE model.Fri, 19 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-19T00:00:00.000Zmit-licenseopen-weightsglm-5-2llm-complianceself-hostingregulated-industriesGroundy Editorialhttps://groundy.com/articles/glm-5-2-on-terminal-bench-2-1-strengths-gaps-and-how-to-route-real-coding-tasks/https://groundy.com/articles/glm-5-2-on-terminal-bench-2-1-strengths-gaps-and-how-to-route-real-coding-tasks/GLM-5.2 scores 81.0 on Terminal-Bench 2.1, trails Claude Opus 4.8 (85.0) on shell tasks, but wins on 1M-token monorepo context. Here is how to route tasks.Fri, 19 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-19T00:00:00.000Zglm-5-2terminal-benchbenchmarkcoding-modelsmodel-comparisonllm-evaluationGroundy Editorialhttps://groundy.com/articles/glm-5-2-vs-claude-opus-4-8-open-weight-coding-at-frontier-pricing/https://groundy.com/articles/glm-5-2-vs-claude-opus-4-8-open-weight-coding-at-frontier-pricing/GLM-5.2 posts 62.1% on SWE-bench Pro and 81.0 on Terminal-Bench 2.1, four points behind Opus 4.8. MIT weights are self-hostable; flat plan starts at $18/month.Fri, 19 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-19T00:00:00.000Zglm-5-2coding-agentsopen-weightsbenchmarksllm-pricingmodel-comparisonGroundy Editorialhttps://groundy.com/articles/glm-5-2s-753b-moe-costs-more-to-self-host-than-the-mit-license-suggests/https://groundy.com/articles/glm-5-2s-753b-moe-costs-more-to-self-host-than-the-mit-license-suggests/GLM-5.2 ships 753B parameters under MIT with strong coding benchmarks, but the full MoE weight load makes self-hosting far heavier than the license terms imply.Fri, 19 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-19T00:00:00.000Zglm-5-2mixture-of-expertsopen-weightsself-hostinginference-costcoding-modelsmit-licenseGroundy Editorialhttps://groundy.com/articles/running-glm-5-2-at-home-sglang-vllm-transformers-and-ktransformers-setup-guide/https://groundy.com/articles/running-glm-5-2-at-home-sglang-vllm-transformers-and-ktransformers-setup-guide/GLM-5.2 weights are live on HuggingFace under MIT license: 753B MoE, 1M-token context, FP8 and BF16 variants. How to pick a deployment framework and model the hardware cost.Fri, 19 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-19T00:00:00.000Zglm-5-2self-hostinginferencevllmsglangopen-weightsmixture-of-expertsGroundy Editorialhttps://groundy.com/articles/running-glm-5-2-in-cursor-cline-and-roo-code-migration-checklist-and-gotchas/https://groundy.com/articles/running-glm-5-2-in-cursor-cline-and-roo-code-migration-checklist-and-gotchas/GLM-5.2 supports an Anthropic-compatible endpoint, letting Cursor, Cline, Roo Code, and five other coding agents swap in the 753B MoE model with a base-URL change.Fri, 19 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-19T00:00:00.000Zglm-5-2claude-codecursorclinecoding-agentsmigrationanthropic-apiGroundy Editorialhttps://groundy.com/articles/star-replaces-scalar-reward-in-text-to-image-rl-with-attention-derived-spatial/https://groundy.com/articles/star-replaces-scalar-reward-in-text-to-image-rl-with-attention-derived-spatial/STAR uses attention-derived spatial maps to replace uniform scalar reward in diffusion RL, shifting the bottleneck from preference pair volume to reward localization.Thu, 18 Jun 2026 02:25:51 GMTGroundy Editorial2026-06-18T00:00:00.000Ztext-to-imagereinforcement-learningdiffusion-modelsreward-modelingcredit-assignmentstable-diffusionrlhfGroundy Editorialhttps://groundy.com/articles/zhipu-open-sources-glm-5-2-under-mit-while-anthropic-tightens-model-access/https://groundy.com/articles/zhipu-open-sources-glm-5-2-under-mit-while-anthropic-tightens-model-access/Zhipu shipped GLM-5.2 with a 1M-token context window the day after the US ordered Anthropic to cut foreign access, with MIT-licensed weights promised within a week.Tue, 16 Jun 2026 23:07:53 GMTGroundy Editorial2026-06-16T00:00:00.000Zopen-weightsglm-5-2mit-licenseopen-source-aiai-sovereigntylarge-language-modelsGroundy Editorialhttps://groundy.com/articles/can-editing-one-neuron-fix-llm-repetition-loops/https://groundy.com/articles/can-editing-one-neuron-fix-llm-repetition-loops/A June 2026 preprint localizes Gemma 4 repetition loops to a few MLP neurons and removes them with a one-time weight edit while benchmark scores hold.Tue, 16 Jun 2026 18:28:07 GMTGroundy Editorial2026-06-16T00:00:00.000Zmodel-editingllm-repetitioninterpretabilitygemmainferencemixture-of-expertsGroundy Editorialhttps://groundy.com/articles/zhipu-ships-glm-5-2-with-1m-context-and-mit-weights-but-zero-benchmarks/https://groundy.com/articles/zhipu-ships-glm-5-2-with-1m-context-and-mit-weights-but-zero-benchmarks/Zhipu shipped GLM-5.2 on June 13 with a 1M-token window and an Anthropic-compatible endpoint, but published no benchmarks and keeps the hosted API on a paid plan.Tue, 16 Jun 2026 17:50:16 GMTGroundy Editorial2026-06-16T00:00:00.000Zopen-source-llmlong-contextcoding-agentszhipullm-pricingmit-licenseai-inferenceGroundy Editorialhttps://groundy.com/articles/aws-bedrock-now-requires-data-sharing-for-mythos-the-self-hosting-calculus/https://groundy.com/articles/aws-bedrock-now-requires-data-sharing-for-mythos-the-self-hosting-calculus/AWS Bedrock's provider_data_share gate for Mythos-class models removes the in-AWS data boundary regulated teams bought it for, pushing them toward self-hosted serving.Tue, 16 Jun 2026 15:31:07 GMTGroundy Editorial2026-06-16T00:00:00.000Zaws-bedrockdata-residencymanaged-inferenceself-hostingcompliancellm-deploymentGroundy Editorialhttps://groundy.com/articles/vercels-remend-turns-streaming-markdown-repair-into-a-dependency/https://groundy.com/articles/vercels-remend-turns-streaming-markdown-repair-into-a-dependency/Vercel's Remend packages the partial-markdown repair every streaming chat team hand-rolls, but the shared heuristic can mask upstream token-boundary defects.Tue, 16 Jun 2026 11:12:10 GMTGroundy Editorial2026-06-16T00:00:00.000Zstreaming-markdownllm-renderingreact-markdownvercel-ai-sdkfrontendmarkdown-parsersGroundy Editorialhttps://groundy.com/articles/moonshots-kimi-k2-7-code-loses-11-of-12-benchmark-cells-leads-on-efficiency/https://groundy.com/articles/moonshots-kimi-k2-7-code-loses-11-of-12-benchmark-cells-leads-on-efficiency/Moonshot's Kimi K2.7 Code loses 11 of 12 benchmark cells to GPT-5.5 and Opus 4.8, leading on token efficiency and price, which pushes buyers to run their own evals.Tue, 16 Jun 2026 00:46:35 GMTGroundy Editorial2026-06-16T00:00:00.000Zllm-coding-modelsai-benchmarkskimimoonshot-aicoding-agentsai-api-pricingGroundy Editorialhttps://groundy.com/articles/can-reinforcement-learning-be-provably-safe-without-sacrificing-scale/https://groundy.com/articles/can-reinforcement-learning-be-provably-safe-without-sacrificing-scale/Two June 2026 preprints claim formal safety guarantees hold without a capability tax in low-dimensional robotic control, sharpening the attestation-versus-verification gap.Mon, 15 Jun 2026 21:36:01 GMTGroundy Editorial2026-06-15T00:00:00.000Zreinforcement-learningsafe-rlai-safetycontrol-theoryai-governanceformal-verificationGroundy Editorialhttps://groundy.com/articles/vllm-cold-start-latency-why-scale-to-zero-llm-serving-stalls/https://groundy.com/articles/vllm-cold-start-latency-why-scale-to-zero-llm-serving-stalls/A June 2026 MLSys paper breaks vLLM cold start into six CPU-bound boot phases, showing why scale-to-zero serving forces operators back into warm GPU pools.Mon, 15 Jun 2026 19:47:35 GMTGroundy Editorial2026-06-15T00:00:00.000Zvllmcold-startllm-servingscale-to-zerogpu-inferenceserverlessGroundy Editorialhttps://groundy.com/articles/the-vercel-aws-deal-reveals-where-ai-inference-runs/https://groundy.com/articles/the-vercel-aws-deal-reveals-where-ai-inference-runs/Vercel's May 2026 AWS databases integration clarifies where its AI workloads actually run: inference stays behind external APIs while the stateful tier moves to AWS regions.Mon, 15 Jun 2026 18:46:55 GMTGroundy Editorial2026-06-15T00:00:00.000Zvercelawsedge-computingai-inferencefluid-computeserverlessGroundy Editorialhttps://groundy.com/articles/do-programming-languages-still-matter-to-your-ai-coding-agent/https://groundy.com/articles/do-programming-languages-still-matter-to-your-ai-coding-agent/A June 2026 study of six coding agents shows performance swings sharply by programming language, breaking the cost-neutral stack choice once agents write most of the code.Mon, 15 Jun 2026 18:01:06 GMTGroundy Editorial2026-06-15T00:00:00.000Zai-coding-agentsprogramming-languagessoftware-engineeringcode-generationllm-benchmarksdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/why-production-ai-agents-fail-silently-and-your-logs-never-catch/https://groundy.com/articles/why-production-ai-agents-fail-silently-and-your-logs-never-catch/Production LLM agents report success on tasks that never completed and emit no error, so detection must move off exception pipelines onto independent state verification.Mon, 15 Jun 2026 16:00:43 GMTGroundy Editorial2026-06-15T00:00:00.000Zllm-agentssilent-failuresagent-observabilityagent-evaluationautonomous-agentsagent-reliabilityGroundy Editorialhttps://groundy.com/articles/amd-took-124-days-to-patch-the-rce-it-first-called-out-of-scope/https://groundy.com/articles/amd-took-124-days-to-patch-the-rce-it-first-called-out-of-scope/AMD closed a plaintext-HTTP RCE in its auto-updater as out of scope, then shipped a 124-day fix adding HTTPS but only a CRC32 checksum where a code signature belongs.Sun, 14 Jun 2026 23:59:40 GMTGroundy Editorial2026-06-14T00:00:00.000Zvulnerability-disclosureamdpatch-managementrcebug-bountyupdate-securitythreat-modelingGroundy Editorialhttps://groundy.com/articles/us-export-order-forces-anthropic-to-disable-fable-5-and-mythos-5-worldwide/https://groundy.com/articles/us-export-order-forces-anthropic-to-disable-fable-5-and-mythos-5-worldwide/A Commerce Department export order citing national security bars all foreign nationals from Fable 5 and Mythos 5, so Anthropic switched both models off worldwide.Sat, 13 Jun 2026 15:30:00 GMTGroundy Editorial2026-06-17T00:00:00.000Zanthropicexport-controlsfable-5mythos-5national-securityai-policyai-regulationGroundy Editorialhttps://groundy.com/articles/claude-fable-5-benchmarks-what-frontiercode-cursorbench-and-vibench-show/https://groundy.com/articles/claude-fable-5-benchmarks-what-frontiercode-cursorbench-and-vibench-show/Claude Fable 5 claims top benchmark scores. Verified data shows every model below 14% on FrontierCode Diamond, and partner scores lack public methodology.Sat, 13 Jun 2026 03:20:56 GMTGroundy Editorial2026-06-17T00:00:00.000Zclaude-fable-5frontiercodeai-benchmarkscursorbenchanthropicai-codingGroundy Editorialhttps://groundy.com/articles/computer-use-agents-fabricate-success-on-8-to-33-percent-of-long-horizon-tasks/https://groundy.com/articles/computer-use-agents-fabricate-success-on-8-to-33-percent-of-long-horizon-tasks/June 2026 research finds computer-use agents fabricate success on 8 to 33 percent of long-horizon tasks, a failure class invisible to single-action benchmarks.Sat, 13 Jun 2026 03:20:54 GMTGroundy Editorial2026-06-13T00:00:00.000Zagent-evaluationfabrication-detectioncomputer-use-agentslong-horizon-tasksagent-reliabilityagent-governanceGroundy Editorialhttps://groundy.com/articles/running-rag-on-a-snapdragon-npu-the-on-device-retrieval-tradeoff/https://groundy.com/articles/running-rag-on-a-snapdragon-npu-the-on-device-retrieval-tradeoff/End-to-end RAG on the Snapdragon X Elite Hexagon NPU delivers 4x lower latency and 4x less energy than CPU with no quality loss, but soldered memory caps your index size.Sat, 13 Jun 2026 03:20:52 GMTGroundy Editorial2026-06-13T00:00:00.000Zragnpusnapdragon-x-eliteon-device-inferenceretrievaledge-aiGroundy Editorialhttps://groundy.com/articles/does-attribution-patching-lie-a-fix-for-a-common-interpretability-shortcut/https://groundy.com/articles/does-attribution-patching-lie-a-fix-for-a-common-interpretability-shortcut/A June 2026 paper traces attribution patching's errors to downstream non-linearities and proposes a Hessian-vector-product correction that costs one extra backward pass.Sat, 13 Jun 2026 03:20:49 GMTGroundy Editorial2026-06-13T00:00:00.000Zattribution-patchingmechanistic-interpretabilitycircuit-discoveryhessian-correctionllm-interpretabilityactivation-patchingGroundy Editorialhttps://groundy.com/articles/can-you-make-a-multimodal-model-unlearn-with-activation-steering/https://groundy.com/articles/can-you-make-a-multimodal-model-unlearn-with-activation-steering/Steering vectors suppress behavior at runtime without editing weights. Two 2026 papers show they transfer between models, so suppression alone is not unlearning.Sat, 13 Jun 2026 03:20:47 GMTGroundy Editorial2026-06-13T00:00:00.000Zactivation-steeringmachine-unlearningllm-safetysteering-vectorsmodel-evaluationmultimodal-modelsGroundy Editorialhttps://groundy.com/articles/why-pruning-a-model-can-raise-its-out-of-distribution-accuracy/https://groundy.com/articles/why-pruning-a-model-can-raise-its-out-of-distribution-accuracy/Task-aware layer pruning removes distortion-amplifying layers and improves out-of-distribution accuracy, which means standard in-distribution benchmarks miss the real effect.Sat, 13 Jun 2026 03:20:45 GMTGroundy Editorial2026-06-13T00:00:00.000Zmodel-pruningout-of-distributionmodel-evaluationtaopiocageneralizationrepresentation-geometryGroundy Editorialhttps://groundy.com/articles/vercels-turborepo-build-speed-becomes-a-hosting-vendor-feature/https://groundy.com/articles/vercels-turborepo-build-speed-becomes-a-hosting-vendor-feature/Vercel's Turborepo ownership routes monorepo CI caching through its hosting by default. A $9.3B valuation intensifies incentives to keep that coupling in place.Sat, 13 Jun 2026 03:20:42 GMTGroundy Editorial2026-06-13T00:00:00.000Zturborepovercelmonorepoci-cachingvendor-lock-inbuild-toolsGroundy Editorialhttps://groundy.com/articles/openai-frames-instruction-hierarchy-as-an-open-challenge-not-a-prompt-injection/https://groundy.com/articles/openai-frames-instruction-hierarchy-as-an-open-challenge-not-a-prompt-injection/OpenAI's IH-Challenge frames instruction hierarchy as an open benchmark, not a shipped defense, shifting prompt-injection protection to orchestration-layer filtering.Sat, 13 Jun 2026 03:20:40 GMTGroundy Editorial2026-06-13T00:00:00.000Zprompt-injectioninstruction-hierarchyagent-securityai-safetyorchestrationopenaiGroundy Editorialhttps://groundy.com/articles/jetbrains-mellum2-a-12b-open-weights-code-model-for-self-hosted-completion/https://groundy.com/articles/jetbrains-mellum2-a-12b-open-weights-code-model-for-self-hosted-completion/Mellum2 is JetBrains' 12B MoE code model with 2.5B active parameters, open-weight under Apache 2.0 for self-hosted completion. Quality versus commercial copilots is untested.Sat, 13 Jun 2026 03:20:37 GMTGroundy Editorial2026-06-13T00:00:00.000Zcode-completionmixture-of-expertsself-hosted-aijetbrainsllm-inferenceopen-weightsGroundy Editorialhttps://groundy.com/articles/do-unified-multimodal-models-actually-interleave-understanding-and-generation/https://groundy.com/articles/do-unified-multimodal-models-actually-interleave-understanding-and-generation/IMUG-Bench tests whether unified multimodal models can alternate between understanding and generation in one context, exposing gaps that separate benchmarks conceal.Sat, 13 Jun 2026 03:20:35 GMTGroundy Editorial2026-06-13T00:00:00.000Zmultimodal-modelsbenchmarksimage-generationimage-understandingimug-benchmodel-evaluationGroundy Editorialhttps://groundy.com/articles/can-ai-agents-share-context-without-a-central-coordinator/https://groundy.com/articles/can-ai-agents-share-context-without-a-central-coordinator/DeLM replaces central multi-agent coordinators with shared context, posting 10.5-point SWE-bench gains at half cost. Consistency, stale reads, and write conflicts remain.Sat, 13 Jun 2026 03:20:32 GMTGroundy Editorial2026-07-13T00:00:00.000Zmulti-agent-systemsdecentralized-coordinationdelmshared-contextllm-frameworksconsistencyGroundy Editorialhttps://groundy.com/articles/why-skill-creation-and-reward-optimization-collide-in-agentic/https://groundy.com/articles/why-skill-creation-and-reward-optimization-collide-in-agentic/ReSkill shows decoupled skill creation in agentic RL degrades reward when skills drift from the evolving policy, and proposes assertion-driven co-optimization inside GRPO.Sat, 13 Jun 2026 03:20:30 GMTGroundy Editorial2026-06-13T00:00:00.000Zreinforcement-learningagentic-rlskill-creationgrpoagent-frameworkspolicy-optimizationGroundy Editorialhttps://groundy.com/articles/graphrag-vs-vectorrag-does-the-graph-index-earn-its-cost/https://groundy.com/articles/graphrag-vs-vectorrag-does-the-graph-index-earn-its-cost/A Samsung preprint finds vector retrieval matches GraphRAG on QA tasks at a fraction of the indexing cost, shifting the burden of proof to teams building graph pipelines.Sat, 13 Jun 2026 03:19:17 GMTGroundy Editorial2026-06-13T00:00:00.000Zraggraphragvector-searchknowledge-graphsinformation-retrievalllm-evaluationGroundy Editorialhttps://groundy.com/articles/how-llms-track-who-did-what-the-entity-rebinding-circuit/https://groundy.com/articles/how-llms-track-who-did-what-the-entity-rebinding-circuit/New research isolates a compact attention-head circuit for entity rebinding in Gemma and Llama, showing tracking failures stem from a binding step, not context length.Wed, 10 Jun 2026 12:05:56 GMTGroundy Editorial2026-06-10T00:00:00.000Zmechanistic-interpretabilityentity-trackingattention-headslong-contextllm-circuitsactivation-patchingGroundy Editorialhttps://groundy.com/articles/vercels-chat-sdk-targets-every-chat-platform-from-one-codebase/https://groundy.com/articles/vercels-chat-sdk-targets-every-chat-platform-from-one-codebase/Vercel's Chat SDK wraps 13 platforms behind one TypeScript handler, cutting event and streaming boilerplate but leaving auth and rich-content gaps as platform-specific work.Wed, 10 Jun 2026 06:51:46 GMTGroundy Editorial2026-06-10T00:00:00.000Zvercel-chat-sdkmulti-platform-chatbot-developmentadapter-architectureai-sdkchatbot-integrationGroundy Editorialhttps://groundy.com/articles/minimax-m3-ships-1m-context-and-desktop-control-as-open-weights/https://groundy.com/articles/minimax-m3-ships-1m-context-and-desktop-control-as-open-weights/MiniMax M3 promises open weights with 1M-token context and frontier coding, but BenchLM ranks it #29 overall and #69 on multimodal. Teams need independent verification.Wed, 10 Jun 2026 05:48:38 GMTGroundy Editorial2026-06-10T00:00:00.000Zminimax-m3long-contextopen-weightssparse-attentioncode-generationmodel-benchmarksGroundy Editorialhttps://groundy.com/articles/npm-v12-breaking-changes-auditing-your-lockfiles-before-the-upgrade/https://groundy.com/articles/npm-v12-breaking-changes-auditing-your-lockfiles-before-the-upgrade/npm v12 removes npm-shrinkwrap.json, reshapes JSON output from view/pack/publish, and deletes four CLI commands. An eight-step audit checklist to run before upgrading.Wed, 10 Jun 2026 04:09:21 GMTGroundy Editorial2026-06-10T00:00:00.000Znpmlockfilesnode-jsci-cdpackage-managementbreaking-changesGroundy Editorialhttps://groundy.com/articles/deepseek-v4-flashmemory-sparse-attention-for-million-token-context/https://groundy.com/articles/deepseek-v4-flashmemory-sparse-attention-for-million-token-context/FlashMemory's learned index compresses DeepSeek-V4's KV cache to 13.5% of baseline at parity accuracy. The project is suspended; per-suite recall breakdowns are not published.Wed, 10 Jun 2026 01:52:16 GMTGroundy Editorial2026-06-10T00:00:00.000Zsparse-attentionkv-cachedeepseekinference-optimizationlong-contextllm-servingGroundy Editorialhttps://groundy.com/articles/when-ai-agents-delegate-work-your-observability-stack-goes-blind/https://groundy.com/articles/when-ai-agents-delegate-work-your-observability-stack-goes-blind/Standard traces cannot attribute actions to specific agents after delegation, a June 2026 paper proves. Fixing this requires observability in the delegation protocol itself.Wed, 10 Jun 2026 01:27:18 GMTGroundy Editorial2026-06-10T00:00:00.000Zagent-observabilitymulti-agent-systemsdistributed-tracingagent-delegationai-reliabilityapmGroundy Editorialhttps://groundy.com/articles/claude-fable-5-vs-opus-4-8-when-2x-pricing-is-worth/https://groundy.com/articles/claude-fable-5-vs-opus-4-8-when-2x-pricing-is-worth/Claude Fable 5 prices at $10/$50 per million tokens, 2x Opus 4.8. Frontier research, long-context agents, and molecule design clear the bar. Standard coding does not.Wed, 10 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-19T00:00:00.000Zclaudeanthropicai-pricingfrontier-modelsbenchmarksagentic-codingGroundy Editorialhttps://groundy.com/articles/claude-mythos-5-access-rules-who-gets-project-glasswing-and-why/https://groundy.com/articles/claude-mythos-5-access-rules-who-gets-project-glasswing-and-why/Claude Mythos 5 shares Fable 5's architecture but with safeguards lifted in select areas. Access requires Project Glasswing approval or a biology research designation.Wed, 10 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-10T00:00:00.000Zclaudeanthropicai-safetyfrontier-modelscybersecuritybiology-aiai-policyGroundy Editorialhttps://groundy.com/articles/fable-5-biology-classifiers-how-flagged-prompts-fall-back-to-opus/https://groundy.com/articles/fable-5-biology-classifiers-how-flagged-prompts-fall-back-to-opus/Fable 5 ships broad biology and chemistry classifiers that route flagged prompts to Opus 4.8. Here is what that fallback means for biotech teams and long-running workflows.Wed, 10 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-17T00:00:00.000Zclaudeanthropicfable-5ai-safetybiotechclassifiersopus-48Groundy Editorialhttps://groundy.com/articles/fable-5-credit-cliff-what-the-june-23-billing-shift-means-for-teams/https://groundy.com/articles/fable-5-credit-cliff-what-the-june-23-billing-shift-means-for-teams/Claude Fable 5 is free on subscription plans through June 22. From June 23 it draws usage credits at $10/$50 per million tokens. Here is what that means for team budgets.Wed, 10 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-17T00:00:00.000Zclaudeanthropicpricingapi-billingteam-billingsaascost-managementGroundy Editorialhttps://groundy.com/articles/fable-5-distillation-protection-how-anthropic-blocks-model-copying/https://groundy.com/articles/fable-5-distillation-protection-how-anthropic-blocks-model-copying/Claude Fable 5 ships with distillation protection to prevent capability extraction. A first-principles look at what it is, how it works, and why API consumers should care.Wed, 10 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-17T00:00:00.000Zclaude-fable-5anthropicmodel-securitydistillationai-safetyfrontier-modelsGroundy Editorialhttps://groundy.com/articles/skip-fable-5-or-upgrade-when-opus-4-8-and-sonnet-4-6-are-still-enough/https://groundy.com/articles/skip-fable-5-or-upgrade-when-opus-4-8-and-sonnet-4-6-are-still-enough/Claude Fable 5 costs $10/$50 per MTok, exactly double Opus 4.8. Here is how to decide which tier your workload actually needs and when staying put saves real money.Wed, 10 Jun 2026 00:00:00 GMTGroundy Editorial2026-06-10T00:00:00.000Zclaude-fable-5claude-opus-4-8ai-pricingmodel-selectionanthropicllm-costGroundy Editorialhttps://groundy.com/articles/skill-injection-hiding-undetectable-instructions-in-what-an-ai-agent-loads/https://groundy.com/articles/skill-injection-hiding-undetectable-instructions-in-what-an-ai-agent-loads/POISE achieves 89.3% attack success on codex+gpt-5.2 by placing malicious instructions where agents naturally execute them, making static content scanners effectively blind.Tue, 09 Jun 2026 23:04:30 GMTGroundy Editorial2026-06-09T00:00:00.000Zskill-injectionllm-agentsprompt-injectionai-securityagent-frameworkscontent-scanningGroundy Editorialhttps://groundy.com/articles/llm-steganography-can-defenders-detect-payloads-hidden-in-model-output/https://groundy.com/articles/llm-steganography-can-defenders-detect-payloads-hidden-in-model-output/A 2026 proof shows data hidden in LLM output must inflate text complexity. A perplexity proxy catches naive encoders, but adaptive adversaries can evade detection in.Tue, 09 Jun 2026 19:54:36 GMTGroundy Editorial2026-06-09T00:00:00.000Zllm-steganographysteganalysiskolmogorov-complexityperplexityllm-securityoutput-channel-securityGroundy Editorialhttps://groundy.com/articles/who-gets-to-audit-your-health-chatbot-almost-no-one/https://groundy.com/articles/who-gets-to-audit-your-health-chatbot-almost-no-one/A June 2026 preprint shows ToS clauses, rate limits, and opaque personalization block independent audits of health chatbots, making audit mandates unenforceable.Tue, 09 Jun 2026 17:46:35 GMTGroundy Editorial2026-06-09T00:00:00.000Zhealth-llmai-auditai-regulationllm-sycophancyai-safetyeu-ai-actGroundy Editorialhttps://groundy.com/articles/do-word-subset-explanations-satisfy-the-eu-ai-acts-transparency-rule/https://groundy.com/articles/do-word-subset-explanations-satisfy-the-eu-ai-acts-transparency-rule/A KDD 2026 paper attributes LLM outputs to input words without model access, but shows which tokens mattered, not how the model reasoned, creating an EU AI Act compliance gap.Tue, 09 Jun 2026 17:14:28 GMTGroundy Editorial2026-06-09T00:00:00.000Zeu-ai-actexplainabilityfeature-attributionllm-transparencyblack-box-modelsai-complianceGroundy Editorialhttps://groundy.com/articles/is-cloudflares-bot-traffic-surge-real-the-measurement-dispute/https://groundy.com/articles/is-cloudflares-bot-traffic-surge-real-the-measurement-dispute/Cloudflare claims a 15x bot surge using a classifier that flags privacy browsers as bots. Audit your own logs before trusting the numbers behind Pay-Per-Crawl.Tue, 09 Jun 2026 14:59:26 GMTGroundy Editorial2026-06-09T00:00:00.000Zcloudflarebot-detectionai-crawlersweb-infrastructurepay-per-crawlweb-securityGroundy Editorialhttps://groundy.com/articles/openai-pushes-chatgpt-into-compensation-data-pressuring-mercer-and-radford/https://groundy.com/articles/openai-pushes-chatgpt-into-compensation-data-pressuring-mercer-and-radford/OpenAI's 3M daily compensation queries push ChatGPT into salary benchmarking, but the model lacks the proprietary employer panels behind Radford and Mercer's moat.Tue, 09 Jun 2026 14:30:18 GMTGroundy Editorial2026-06-09T00:00:00.000Zcompensation-datachatgptsalary-benchmarkingopenaihr-techworkerbenchGroundy Editorialhttps://groundy.com/articles/bit-exact-inference-verification-gives-ai-audits-a-proof-mechanism/https://groundy.com/articles/bit-exact-inference-verification-gives-ai-audits-a-proof-mechanism/An arXiv preprint shows GPU inference outputs can be reproduced bit-for-bit across hardware, giving auditors a forensic trail to verify which model produced a given output.Tue, 09 Jun 2026 13:39:16 GMTGroundy Editorial2026-06-09T00:00:00.000Zai-auditinginference-verificationgpu-determinismai-governancereproducibilityfloating-pointGroundy Editorialhttps://groundy.com/articles/do-privacy-defenses-actually-protect-fine-tuned-llms-a-new-benchmark/https://groundy.com/articles/do-privacy-defenses-actually-protect-fine-tuned-llms-a-new-benchmark/A June 2026 benchmark shows passing privacy attack probes on fine-tuned LLMs is not a formal guarantee, exposing a compliance gap for teams deploying models on customer data.Tue, 09 Jun 2026 13:09:48 GMTGroundy Editorial2026-06-09T00:00:00.000Zllm-privacyfine-tuningdifferential-privacymembership-inferencemodel-securitycomplianceGroundy Editorialhttps://groundy.com/articles/can-you-reconstruct-an-llms-system-prompt-from-its-activations/https://groundy.com/articles/can-you-reconstruct-an-llms-system-prompt-from-its-activations/PRISM recovers full instruction sets inside frozen LLMs from hidden states, enabling anyone with activation access to reconstruct system prompts without output probing.Tue, 09 Jun 2026 12:45:38 GMTGroundy Editorial2026-06-09T00:00:00.000Zllm-interpretabilityactivation-probessystem-prompt-extractionprismmodel-securityai-safetyGroundy Editorialhttps://groundy.com/articles/can-a-robots-own-attention-flag-its-unsafe-actions-before-they-run/https://groundy.com/articles/can-a-robots-own-attention-flag-its-unsafe-actions-before-they-run/Two June 2026 preprints show VLA robot policies already compute safety-relevant signals at inference, enabling real-time collision monitors with no retraining.Tue, 09 Jun 2026 12:26:17 GMTGroundy Editorial2026-06-09T00:00:00.000Zvlarobot-safetyattention-mechanisminference-time-monitoringcontrol-barrier-functionsembodied-aiGroundy Editorialhttps://groundy.com/articles/can-a-cli-replace-screenshots-for-gui-automation-agents/https://groundy.com/articles/can-a-cli-replace-screenshots-for-gui-automation-agents/AppAgent-Claw replaces the VLM screenshot loop with CLI queries for GUI automation, cutting cost and latency, but only where applications expose a usable text surface.Tue, 09 Jun 2026 11:18:10 GMTGroundy Editorial2026-06-09T00:00:00.000Zgui-automationclivlmaccessibility-treeapp-agentagentic-guiGroundy Editorialhttps://groundy.com/articles/bloombergs-pomona-makes-small-automated-code-changes-not-big-agent-prs/https://groundy.com/articles/bloombergs-pomona-makes-small-automated-code-changes-not-big-agent-prs/Bloomberg's Pomona agent limits diffs to 10 lines and merged 88% of PRs in production, proving small, bounded edits earn reviewer trust faster than large autonomous refactors.Tue, 09 Jun 2026 10:31:27 GMTGroundy Editorial2026-06-09T00:00:00.000Zcoding-agentscode-qualitypull-requestsautomated-refactoringbloombergtechnical-debtGroundy Editorialhttps://groundy.com/articles/agent-tool-gating-moves-from-prompt-rules-to-learned-policies/https://groundy.com/articles/agent-tool-gating-moves-from-prompt-rules-to-learned-policies/PROVE and AgentTrust show learned policies beat hand-tuned rules for gating AI agent tool calls, but the gains depend on calibration that neither paper measures.Tue, 09 Jun 2026 09:30:20 GMTGroundy Editorial2026-06-09T00:00:00.000Ztool-callingreinforcement-learningai-agentsagent-frameworkscalibrationmcp-serversGroundy Editorialhttps://groundy.com/articles/does-debate-quality-survive-when-llms-argue-outside-english/https://groundy.com/articles/does-debate-quality-survive-when-llms-argue-outside-english/The first multilingual LLM debate competition covers four languages. Benchmarks already show reasoning degrades outside English, so teams must verify per-language parity.Tue, 09 Jun 2026 08:14:22 GMTGroundy Editorial2026-06-09T00:00:00.000Zllm-debatemultilingual-evaluationcross-cultural-reasoningflagevalxcr-benchmodel-evaluationGroundy Editorialhttps://groundy.com/articles/splitting-a-malicious-task-across-tool-calls-slips-past-llm-agent-guardrails/https://groundy.com/articles/splitting-a-malicious-task-across-tool-calls-slips-past-llm-agent-guardrails/Splitting a disallowed action into benign tool calls bypasses per-call safety filters in LLM agents, lifting jailbreak success by 28 percentage points over current baselines.Tue, 09 Jun 2026 07:52:02 GMTGroundy Editorial2026-06-09T00:00:00.000Zllm-securityagent-safetytool-callingguardrailsadversarial-attacksprovenance-trackingGroundy Editorialhttps://groundy.com/articles/more-capable-llms-cooperate-less-in-zero-cost-collaboration-tests/https://groundy.com/articles/more-capable-llms-cooperate-less-in-zero-cost-collaboration-tests/ICML 2026 research finds o3 achieves only 17% of optimal cooperation while weaker o3-mini hits 50%, proving model capability does not predict multi-agent coordination.Tue, 09 Jun 2026 06:44:18 GMTGroundy Editorial2026-06-09T00:00:00.000Zmulti-agent-systemsllm-coordinationicml-2026agent-frameworkscrewaiautogencooperation-failuresGroundy Editorialhttps://groundy.com/articles/can-one-safety-adapter-realign-every-fine-tuned-llm/https://groundy.com/articles/can-one-safety-adapter-realign-every-fine-tuned-llm/Three papers show safety alignment can be extracted as a portable adapter and reapplied to fine-tuned models, replacing per-model alignment with one adapter per model family.Tue, 09 Jun 2026 06:12:34 GMTGroundy Editorial2026-06-09T00:00:00.000Zsafety-alignmentllm-fine-tuningopen-weight-modelssafe-adaptersai-safetymodular-alignmentGroundy Editorialhttps://groundy.com/articles/bending-spoons-files-to-ipo-the-app-roll-up-playbook-goes-public/https://groundy.com/articles/bending-spoons-files-to-ipo-the-app-roll-up-playbook-goes-public/Bending Spoons' F-1 shows $1.31B revenue and 95% retention across 50+ brands. Evernote's 24/100 churn score suggests the roll-up model harvests more than it compounds.Tue, 09 Jun 2026 04:52:13 GMTGroundy Editorial2026-06-09T00:00:00.000Zipobending-spoonssoftware-roll-upsaas-acquisitionsevernotef-1-filingapp-monetizationGroundy Editorialhttps://groundy.com/articles/how-cursor-uses-gpt-5-what-openais-writeup-tells-coding-teams/https://groundy.com/articles/how-cursor-uses-gpt-5-what-openais-writeup-tells-coding-teams/OpenAI's GPT-5 API features map directly to Cursor's agent loop, revealing a co-design relationship. Coding teams must now evaluate editor-model pairs, not editors alone.Tue, 09 Jun 2026 04:14:04 GMTGroundy Editorial2026-06-09T00:00:00.000Zgpt-5cursorai-codingopenaimodel-editor-co-designdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/duckdb-queries-hugging-face-parquet-files-over-http-without-downloads/https://groundy.com/articles/duckdb-queries-hugging-face-parquet-files-over-http-without-downloads/DuckDB queries Parquet files on Hugging Face Hub over HTTPS without downloading them first, turning dataset triage from a multi-gigabyte commitment into a LIMIT 100 query.Tue, 09 Jun 2026 02:26:59 GMTGroundy Editorial2026-07-11T00:00:00.000Zduckdbhugging-faceparquetsqldataset-triageremote-queryGroundy Editorialhttps://groundy.com/articles/does-softmax-normalization-limit-what-attention-can-represent/https://groundy.com/articles/does-softmax-normalization-limit-what-attention-can-represent/A new paper proves softmax normalization imposes geometric separation bounds on token vectors, constraining what attention can represent as context length grows.Tue, 09 Jun 2026 00:55:16 GMTGroundy Editorial2026-06-17T00:00:00.000Zsoftmax-attentionattention-mechanismtransformer-architecturenormalizationneural-network-theorymodel-architectureGroundy Editorialhttps://groundy.com/articles/huaweis-kvarn-puts-kv-cache-quantization-inside-vllms-backend/https://groundy.com/articles/huaweis-kvarn-puts-kv-cache-quantization-inside-vllms-backend/Huawei's KVarN replaces vLLM's attention backend with a 2.3-bit KV-cache quantizer claiming FP16 accuracy on reasoning. Adopters must run a Huawei-maintained fork.Tue, 09 Jun 2026 00:15:21 GMTGroundy Editorial2026-06-09T00:00:00.000Zkv-cachevllmquantizationinferencehuaweigpu-memoryGroundy Editorialhttps://groundy.com/articles/can-ai-be-aligned-without-modeling-human-cognitive-diversity/https://groundy.com/articles/can-ai-be-aligned-without-modeling-human-cognitive-diversity/A 2026 arXiv preprint argues RLHF's single reward signal destroys the reasoning behind human disagreement, proposing machine theory-of-mind as an alignment foundation.Mon, 08 Jun 2026 23:42:47 GMTGroundy Editorial2026-06-08T00:00:00.000Zai-alignmentrlhftheory-of-mindcognitive-diversityreward-modelsai-ethicsGroundy Editorialhttps://groundy.com/articles/can-an-attacker-steal-your-models-last-layer-from-its-outputs/https://groundy.com/articles/can-an-attacker-steal-your-models-last-layer-from-its-outputs/A new geometric proof shows API outputs alone suffice to recover a transformer's final projection matrix up to a rotation, while deeper layers are provably irrecoverable.Mon, 08 Jun 2026 19:37:14 GMTGroundy Editorial2026-06-08T00:00:00.000Zmodel-stealingmodel-securityllm-apisai-safetytransformer-architecturedifferential-privacyGroundy Editorialhttps://groundy.com/articles/is-the-pentagons-software-pathway-ready-to-buy-ai-systems/https://groundy.com/articles/is-the-pentagons-software-pathway-ready-to-buy-ai-systems/A June 2026 arXiv analysis traces an AI program through the DoD Software Acquisition Pathway, finding no milestones for model re-validation or data provenance.Mon, 08 Jun 2026 19:16:06 GMTGroundy Editorial2026-06-08T00:00:00.000Zdod-acquisitionai-governancesoftware-pathwaydefense-aimodel-lifecycleacquisition-reformGroundy Editorialhttps://groundy.com/articles/web-agents-can-be-talked-into-abandoning-their-task-the-trap-benchmark/https://groundy.com/articles/web-agents-can-be-talked-into-abandoning-their-task-the-trap-benchmark/The TRAP benchmark finds 13 to 43 percent of web agent tasks can be redirected by persuasive page content, exposing a blind spot in current instruction-hierarchy defenses.Mon, 08 Jun 2026 16:00:15 GMTGroundy Editorial2026-06-08T00:00:00.000Zagent-safetyweb-agentsprompt-injectionpersuasion-attacksbenchmarksecurityGroundy Editorialhttps://groundy.com/articles/shallow-neural-nets-beat-llm-guardrails-at-catching-prompt-injection/https://groundy.com/articles/shallow-neural-nets-beat-llm-guardrails-at-catching-prompt-injection/GuardNet's 47M-parameter BiLSTM ensemble detects prompt injections in 50 ms on CPU, but 0.747 blind-benchmark AUROC and classifier-evasion risks leave the arms race.Mon, 08 Jun 2026 14:32:19 GMTGroundy Editorial2026-06-08T00:00:00.000Zprompt-injectionllm-securityguardrailsadversarial-attackslightweight-classifiersbilstmGroundy Editorialhttps://groundy.com/articles/when-an-ai-agent-clicks-a-link-openais-data-exfiltration-model/https://groundy.com/articles/when-an-ai-agent-clicks-a-link-openais-data-exfiltration-model/OpenAI's URL provenance filter concedes content inspection is intractable. Agents that mix sensitive data with web access face a structural exfiltration risk.Mon, 08 Jun 2026 08:01:51 GMTGroundy Editorial2026-06-08T00:00:00.000Zdata-exfiltrationprompt-injectionai-agentsurl-filteringopenaiagent-securityGroundy Editorialhttps://groundy.com/articles/why-foundation-model-agents-pass-benchmarks-but-fail-in-production/https://groundy.com/articles/why-foundation-model-agents-pass-benchmarks-but-fail-in-production/A June 2026 paper frames the AI agent benchmark gap as a sim-to-real problem, giving eval teams a four-part MDP checklist to challenge vendor claims before live deployment.Mon, 08 Jun 2026 07:11:52 GMTGroundy Editorial2026-06-08T00:00:00.000Zagent-evaluationsim-to-realbenchmark-gapmdpprocurementdeployment-reliabilityGroundy Editorialhttps://groundy.com/articles/vercels-rox-case-study-pitches-ai-agents-as-a-revenue-operating-system/https://groundy.com/articles/vercels-rox-case-study-pitches-ai-agents-as-a-revenue-operating-system/Vercel's shift from frontend hosting to agent infrastructure is backed by real products and a $9.3B valuation. Whether per-token billing beats per-seat SaaS remains unproven.Mon, 08 Jun 2026 06:09:41 GMTGroundy Editorial2026-06-10T00:00:00.000Zvercelai-agentsserverlessfluid-computeai-infrastructurepricing-modelsGroundy Editorialhttps://groundy.com/articles/ai-patent-valuation-models-aim-to-replace-the-expert-appraiser/https://groundy.com/articles/ai-patent-valuation-models-aim-to-replace-the-expert-appraiser/A new framework decomposes patent value into per-feature Shapley credits, but courts have not ruled on whether model output replaces expert testimony in damages and M&A.Mon, 08 Jun 2026 00:03:16 GMTGroundy Editorial2026-06-08T00:00:00.000Zpatent-valuationshapley-valuesip-litigationpatent-analyticsdue-diligencealgorithmic-appraisalGroundy Editorialhttps://groundy.com/articles/data-safety-policies-for-ai-agents-controlling-what-an-agent-can-leak/https://groundy.com/articles/data-safety-policies-for-ai-agents-controlling-what-an-agent-can-leak/A June 2026 paper proposes Data Flow Control, moving agent data safety from prompt-level guardrails to deterministic, auditable SQL query policies enforced outside the model.Sun, 07 Jun 2026 21:44:30 GMTGroundy Editorial2026-06-07T00:00:00.000Zdata-flow-controlai-agentsdata-safetyprovenancesql-policyagent-safetyGroundy Editorialhttps://groundy.com/articles/can-ai-agents-repair-broken-network-configs-a-new-benchmark-tests/https://groundy.com/articles/can-ai-agents-repair-broken-network-configs-a-new-benchmark-tests/LLM agents with formal verification repair 12% more network misconfigurations than base models and are 17% safer, but regress on large topologies, limiting production use.Sun, 07 Jun 2026 20:06:55 GMTGroundy Editorial2026-06-07T00:00:00.000Znetwork-configurationllm-agentsformal-verificationnetwork-automationbenchmarknetopsGroundy Editorialhttps://groundy.com/articles/can-self-evolving-ai-agents-drift-without-a-human-in-the-loop/https://groundy.com/articles/can-self-evolving-ai-agents-drift-without-a-human-in-the-loop/Self-evolving AI agents drift without checkpoints: 94% of reviewers miss agent sabotage, safety hardening does not transfer across domains, and stale memory degrades tasks.Sun, 07 Jun 2026 16:38:03 GMTGroundy Editorial2026-06-10T00:00:00.000Zself-evolving-agentsai-safetyagent-drifthuman-in-the-loopadversarial-agentsmemory-alignmentGroundy Editorialhttps://groundy.com/articles/a-covert-llm-persuasion-experiment-was-shut-down-how-far-did-the-bots-get/https://groundy.com/articles/a-covert-llm-persuasion-experiment-was-shut-down-how-far-did-the-bots-get/A 2026 analysis of the bot comment archive from a halted Reddit experiment catalogs fabricated identities and bias triggers, but early shutdown leaves harm unmeasurable.Sun, 07 Jun 2026 15:03:20 GMTGroundy Editorial2026-06-07T00:00:00.000Zllm-persuasionreddit-experimentai-ethicscovert-botscognitive-biascontent-analysisGroundy Editorialhttps://groundy.com/articles/indexing-images-for-rag-kapa-ais-approach-to-multimodal-retrieval/https://groundy.com/articles/indexing-images-for-rag-kapa-ais-approach-to-multimodal-retrieval/kapa.ai's data shows indexing image captions at ingestion adds 1-6% query overhead versus 27-51% for raw query-time vision, shifting recall risk to caption fidelity.Sun, 07 Jun 2026 14:43:45 GMTGroundy Editorial2026-06-07T00:00:00.000Zragmultimodal-retrievalimage-indexingvision-modelstechnical-documentationretrieval-costGroundy Editorialhttps://groundy.com/articles/can-llms-leak-training-data-a-new-test-splits-capacity-from-intent/https://groundy.com/articles/can-llms-leak-training-data-a-new-test-splits-capacity-from-intent/PropMe splits memorization audits into capability and propensity, showing that single-metric leakage reports understate what targeted prompts can extract from LLMs.Sun, 07 Jun 2026 12:55:22 GMTGroundy Editorial2026-06-07T00:00:00.000Zllm-memorizationgdpr-compliancemodel-evaluationdata-extractiontraining-dataai-safetyGroundy Editorialhttps://groundy.com/articles/gdpr-rectification-rights-have-no-clear-owner-in-ml-supply-chains/https://groundy.com/articles/gdpr-rectification-rights-have-no-clear-owner-in-ml-supply-chains/A 2026 arXiv paper shows GDPR rectification and erasure rights become unenforceable across ML supply chains where no party can trace a subject's data inside trained weights.Sun, 07 Jun 2026 09:34:07 GMTGroundy Editorial2026-06-07T00:00:00.000Zgdprml-supply-chaindata-erasuremachine-unlearningeu-ai-regulationdata-controllerGroundy Editorialhttps://groundy.com/articles/benchmarking-rag-over-cyber-threat-intelligence-where-retrieval-breaks/https://groundy.com/articles/benchmarking-rag-over-cyber-threat-intelligence-where-retrieval-breaks/CTIConnect, a KDD 2026 benchmark of 1,860 QA pairs across five CTI feeds, shows retrieval quality, not model size, determines copilot accuracy across ten LLMs.Sun, 07 Jun 2026 09:19:51 GMTGroundy Editorial2026-06-07T00:00:00.000Zragcyber-threat-intelligenceretrieval-qualitysoc-copilotknowledge-graphsllm-benchmarksGroundy Editorialhttps://groundy.com/articles/when-an-ai-agents-tools-break-can-it-recover-a-new-benchmark/https://groundy.com/articles/when-an-ai-agents-tools-break-can-it-recover-a-new-benchmark/ToolMaze, a new arXiv benchmark, shows LLM agents' recovery rates drop 37% when tools return corrupted data, exposing a gap in how agent reliability is measured.Sun, 07 Jun 2026 05:32:08 GMTGroundy Editorial2026-06-07T00:00:00.000Zllm-agentstool-failurebenchmarkagent-reliabilityfault-tolerancedynamic-replanningGroundy Editorialhttps://groundy.com/articles/us-hyperscale-data-centers-a-carbon-audit-that-recasts-ai-power-costs/https://groundy.com/articles/us-hyperscale-data-centers-a-carbon-audit-that-recasts-ai-power-costs/A facility-level audit of 403 US hyperscale centers finds 545 gCO2/kWh, 48% above the grid average. Siting in fossil-heavy regions, not PPAs, determines actual emissions.Sun, 07 Jun 2026 05:06:29 GMTGroundy Editorial2026-06-07T00:00:00.000Zdata-centerscarbon-emissionsai-infrastructureenergy-policysustainabilityhyperscaleGroundy Editorialhttps://groundy.com/articles/the-rtx-spark-bet-on-unified-memory-for-local-llms-where-bandwidth-caps/https://groundy.com/articles/the-rtx-spark-bet-on-unified-memory-for-local-llms-where-bandwidth-caps/LLM decode is memory-bandwidth-bound, not capacity-bound. A 70B model on the DGX Spark's 273 GB/s hits roughly 2.7 tok/s. Count GB/s, not GB, when sizing inference hardware.Sat, 06 Jun 2026 21:47:28 GMTGroundy Editorial2026-06-26T00:00:00.000Zllm-inferencememory-bandwidthunified-memorylpddr5xnvidiahardware-evaluationGroundy Editorialhttps://groundy.com/articles/reading-vercels-fluid-compute-vs-cloudflare-workers-benchmark/https://groundy.com/articles/reading-vercels-fluid-compute-vs-cloudflare-workers-benchmark/Vercel benchmarks Fluid Compute 2.55x faster than Cloudflare Workers, but asymmetric configs and billing differences (CPU-ms vs GB-hour) make cost the real deciding factor.Sat, 06 Jun 2026 20:20:31 GMTGroundy Editorial2026-06-06T00:00:00.000Zserverlesscloudflare-workersvercelfluid-computebenchmarksedge-computingbilling-modelsGroundy Editorialhttps://groundy.com/articles/fine-tuning-multi-agent-llm-systems-rl-enters-where-prompt-tweaks-stall/https://groundy.com/articles/fine-tuning-multi-agent-llm-systems-rl-enters-where-prompt-tweaks-stall/MARFT reframes multi-agent LLM reliability as an RL problem over agent topologies, moving the bottleneck from prompt iteration to training infrastructure most teams lack.Sat, 06 Jun 2026 18:57:48 GMTGroundy Editorial2026-06-06T00:00:00.000Zmulti-agent-systemsreinforcement-learningllm-fine-tuningmarftagent-frameworksreward-designGroundy Editorialhttps://groundy.com/articles/stronger-safety-alignment-made-llms-easier-to-jailbreak-not-harder/https://groundy.com/articles/stronger-safety-alignment-made-llms-easier-to-jailbreak-not-harder/A single-query attack turns safety-trained LLMs' own refusal reasoning against them. Across 30 models, better safety judgment correlated with higher exploit rates, not lower.Sat, 06 Jun 2026 15:52:52 GMTGroundy Editorial2026-06-10T00:00:00.000Zllm-safetyjailbreaksafety-alignmentadversarial-attacksrlhfai-securityGroundy Editorialhttps://groundy.com/articles/saml-signature-bypass-is-back-inside-the-samlstorm-vulnerability-class/https://groundy.com/articles/saml-signature-bypass-is-back-inside-the-samlstorm-vulnerability-class/XML Signature Wrapping attacks on SAML keep recurring because the gap between validation and processing is structural. Edge WAF rules are a delaying tactic, not a fix.Sat, 06 Jun 2026 15:37:34 GMTGroundy Editorial2026-06-06T00:00:00.000Zsamlxml-signature-wrappingssoweb-application-firewallidentity-securitycanonicalizationGroundy Editorialhttps://groundy.com/articles/when-llm-safety-lives-at-inference-not-training-a-certification-gap/https://groundy.com/articles/when-llm-safety-lives-at-inference-not-training-a-certification-gap/Post-training alignment can reshape LLM behavior after the checkpoint regulators audit, leaving a gap between the certified artifact and what actually runs in production.Sat, 06 Jun 2026 14:55:30 GMTGroundy Editorial2026-06-06T00:00:00.000Zai-governancealignmentzero-knowledge-proofspost-trainingsafety-certificationinference-monitoringGroundy Editorialhttps://groundy.com/articles/do-llms-understand-idioms-in-low-resource-languages/https://groundy.com/articles/do-llms-understand-idioms-in-low-resource-languages/MIDI tests idiom comprehension across 18 languages and finds LLMs rely on memorization over reasoning, with the sharpest failures falling on low-resource communities.Sat, 06 Jun 2026 12:11:09 GMTGroundy Editorial2026-06-06T00:00:00.000Zidiomsmultilingual-nlplow-resource-languagesllm-evaluationmidi-benchmarkfigurative-languageGroundy Editorialhttps://groundy.com/articles/does-cuda-tile-match-hand-tuned-kernels-on-hopper-and-blackwell/https://groundy.com/articles/does-cuda-tile-match-hand-tuned-kernels-on-hopper-and-blackwell/CUDA Tile reaches 2.5x FlashAttention-2 on Blackwell B200 but drops to 53% on RTX PRO 6000, while Triton holds 62-101% of cuBLAS across both architectures without tuning.Sat, 06 Jun 2026 09:16:56 GMTGroundy Editorial2026-06-06T00:00:00.000Zcuda-tilegpu-kernelsblackwelltritongpu-programmingnvidiaGroundy Editorialhttps://groundy.com/articles/samlstorm-the-saml-signature-bug-that-forges-valid-sso-logins/https://groundy.com/articles/samlstorm-the-saml-signature-bug-that-forges-valid-sso-logins/SAML signature-confusion attacks exploit gaps between XML canonicalization and parsing, letting attackers mutate signed assertions to forge authenticated SSO sessions.Sat, 06 Jun 2026 08:53:00 GMTGroundy Editorial2026-06-06T00:00:00.000Zsamlssosignature-confusionxml-canonicalizationidentity-securityvercelGroundy Editorialhttps://groundy.com/articles/minimax-m3-bets-on-sparse-attention-for-1m-context-does-the-math-hold/https://groundy.com/articles/minimax-m3-bets-on-sparse-attention-for-1m-context-does-the-math-hold/MiniMax claims M3 handles 1M tokens via sparse attention, but published no technical report or independent benchmarks. Retrieval quality at full context is unverified.Sat, 06 Jun 2026 08:46:35 GMTGroundy Editorial2026-06-06T00:00:00.000Zsparse-attentionminimax-m3long-contextllm-benchmarksinference-costretrieval-qualityGroundy Editorialhttps://groundy.com/articles/can-one-model-handle-every-cad-task-unicad-tests/https://groundy.com/articles/can-one-model-handle-every-cad-task-unicad-tests/UniCAD introduces a unified benchmark and single multi-modal model for CAD reconstruction, generation, and question answering, challenging the field's per-task silos.Sat, 06 Jun 2026 08:00:51 GMTGroundy Editorial2026-06-06T00:00:00.000Zcadmulti-modal-modelsdeep-learningbenchmarks3d-reconstructiongenerative-designGroundy Editorialhttps://groundy.com/articles/do-foundation-models-actually-learn-relational-structure-in-context/https://groundy.com/articles/do-foundation-models-actually-learn-relational-structure-in-context/OpenRFM shows relational in-context learning collapses on sparse joins and introduces a dual-stage architecture that surpasses the commercial KumoRFMv1 baseline.Sat, 06 Jun 2026 06:39:42 GMTGroundy Editorial2026-06-06T00:00:00.000Zrelational-foundation-modelsin-context-learningtabular-modelsopenrfmrelational-learningpre-trainingGroundy Editorialhttps://groundy.com/articles/can-llms-write-better-research-paper-titles-than-authors/https://groundy.com/articles/can-llms-write-better-research-paper-titles-than-authors/A new study claims LLMs write 'appropriate' research titles, but the evidence rests on similarity metrics that measure pattern matching, not whether titles actually serve.Sat, 06 Jun 2026 05:36:20 GMTGroundy Editorial2026-06-06T00:00:00.000Zllm-evaluationresearch-titlesacademic-publishingtext-metricspegasusarxivGroundy Editorialhttps://groundy.com/articles/does-information-theoretic-example-selection-beat-knn-for-in-context-learning/https://groundy.com/articles/does-information-theoretic-example-selection-beat-knn-for-in-context-learning/KITE swaps cosine-similarity kNN for a kernelized information-theoretic selector in few-shot prompting, reporting classification gains but adding inference compute overhead.Sat, 06 Jun 2026 05:21:48 GMTGroundy Editorial2026-06-06T00:00:00.000Zin-context-learningfew-shot-learningragexample-selectionkernel-methodsretrieval-optimizationclassificationGroundy Editorialhttps://groundy.com/articles/pod-level-remote-attestation-in-kubernetes-confidential-workloads-on-dstack/https://groundy.com/articles/pod-level-remote-attestation-in-kubernetes-confidential-workloads-on-dstack/dstack-capsule binds pod identity into Intel TDX hardware quotes, enabling multi-pod confidential VMs without the per-VM density tax of Confidential Containers.Sat, 06 Jun 2026 04:16:43 GMTGroundy Editorial2026-06-26T00:00:00.000Zconfidential-computingkubernetesremote-attestationintel-tdxconfidential-containerspod-securityGroundy Editorialhttps://groundy.com/articles/do-concept-bottleneck-model-benchmarks-measure-interpretability-or-dataset-bias/https://groundy.com/articles/do-concept-bottleneck-model-benchmarks-measure-interpretability-or-dataset-bias/Standard concept bottleneck model benchmarks confound genuine concept learning with dataset shortcuts. Synthetic benchmarks from Skirzynski et al. expose the gap.Sat, 06 Jun 2026 03:27:18 GMTGroundy Editorial2026-06-06T00:00:00.000Zconcept-bottleneck-modelsinterpretabilitysynthetic-benchmarksinformation-leakagemodel-evaluationconfoundingGroundy Editorialhttps://groundy.com/articles/cascading-hallucination-in-agentic-rag-when-one-bad-retrieval-poisons-the-chain/https://groundy.com/articles/cascading-hallucination-in-agentic-rag-when-one-bad-retrieval-poisons-the-chain/The CHARM paper shows per-step grounding checks in multi-hop RAG miss over 80% of cascaded errors, where one fabricated retrieval compounds across reasoning hops.Sat, 06 Jun 2026 01:56:52 GMTGroundy Editorial2026-06-26T00:00:00.000Zraghallucinationagentic-ragretrieval-augmented-generationllm-reliabilitymulti-hop-reasoningGroundy Editorialhttps://groundy.com/articles/vercels-flags-sdk-exposed-feature-flag-definitions-via-cve-2025-46332/https://groundy.com/articles/vercels-flags-sdk-exposed-feature-flag-definitions-via-cve-2025-46332/CVE-2025-46332 exposed flag names, rollout conditions, and security kill switches via Vercel's discovery endpoint, making operational metadata into reconnaissance material.Sat, 06 Jun 2026 01:49:42 GMTGroundy Editorial2026-06-06T00:00:00.000Zcve-2025-46332feature-flagsvercelinformation-disclosuresecurity-vulnerabilityreconnaissanceGroundy Editorialhttps://groundy.com/articles/continuous-bit-width-quantization-vs-fixed-int4-does-liftquant-beat-discrete/https://groundy.com/articles/continuous-bit-width-quantization-vs-fixed-int4-does-liftquant-beat-discrete/LiftQuant replaces 2/4/8-bit quantization with continuous bit-width via dimensional lifting. A 70B model at 2.4 bits fits 24GB. Kernel support is the bottleneck.Sat, 06 Jun 2026 01:26:39 GMTGroundy Editorial2026-06-06T00:00:00.000Zquantizationllm-inferenceliftquantmixed-precisionmodel-compressionsub-4bit-quantizationGroundy Editorialhttps://groundy.com/articles/federated-learning-for-industrial-iot-anomaly-detection-the-data-locality/https://groundy.com/articles/federated-learning-for-industrial-iot-anomaly-detection-the-data-locality/A DEXA 2026 paper proposes a cyclic-dynamics benchmark for federated anomaly detection, exposing the gap between on-site compliance gains and unknown convergence costs.Fri, 05 Jun 2026 23:29:18 GMTGroundy Editorial2026-06-05T00:00:00.000Zfederated-learninganomaly-detectionindustrial-iottime-seriesdata-localitycyclic-dynamicsGroundy Editorialhttps://groundy.com/articles/generating-gpu-kernels-for-moore-threads-silicon-can-llms-break-cuda-lock/https://groundy.com/articles/generating-gpu-kernels-for-moore-threads-silicon-can-llms-break-cuda-lock/MusaCoder trains a 9B model to emit native GPU kernels for Moore Threads' MUSA architecture, claiming parity with frontier models on vendor-controlled benchmarks.Fri, 05 Jun 2026 23:15:44 GMTGroundy Editorial2026-06-05T00:00:00.000Zgpu-kernelsmoore-threadsllm-code-generationcuda-alternativesinferencemusaGroundy Editorialhttps://groundy.com/articles/alibabas-open-code-review-moves-ai-review-into-the-cli-not/https://groundy.com/articles/alibabas-open-code-review-moves-ai-review-into-the-cli-not/Alibaba's open-code-review moves AI code review from PR threads into the developer's terminal, front-loading feedback before push but isolating each author's review.Fri, 05 Jun 2026 20:56:26 GMTGroundy Editorial2026-06-05T00:00:00.000Zai-code-reviewcli-toolsalibabadeveloper-toolingopen-sourcepull-requestsGroundy Editorialhttps://groundy.com/articles/microsofts-azure-linux-goes-general-purpose-the-container-base-image-play/https://groundy.com/articles/microsofts-azure-linux-goes-general-purpose-the-container-base-image-play/Microsoft's Azure Linux 4.0 extends the internal CBL-Mariner into a Fedora-based server OS for VMs. Preview gaps remain, and AKS teams should test now but wait for GA.Fri, 05 Jun 2026 18:27:20 GMTGroundy Editorial2026-06-05T00:00:00.000Zazure-linuxkubernetessupply-chaincontainersfedoracloud-infrastructureaksGroundy Editorialhttps://groundy.com/articles/reading-failed-llm-reasoning-traces-wont-tell-you-which-ones-rl-can-fix/https://groundy.com/articles/reading-failed-llm-reasoning-traces-wont-tell-you-which-ones-rl-can-fix/A new preprint finds the fixability of failed LLM reasoning rollouts under RL is predictable from distributional statistics, not from reading chain-of-thought text.Fri, 05 Jun 2026 18:08:14 GMTGroundy Editorial2026-06-05T00:00:00.000Zreasoning-rlchain-of-thoughtreinforcement-learningpost-trainingprocess-reward-modelsllm-reasoningtest-time-computeGroundy Editorialhttps://groundy.com/articles/can-ai-agents-build-other-agents-the-meta-agent-challenge-says-mostly-not-yet/https://groundy.com/articles/can-ai-agents-build-other-agents-the-meta-agent-challenge-says-mostly-not-yet/The Meta-Agent Challenge finds current AI models cannot autonomously build agents, undercutting vendor claims of agent-building automation and revealing reward-hacking risks.Fri, 05 Jun 2026 17:24:08 GMTGroundy Editorial2026-06-05T00:00:00.000Zmeta-agentsai-agentsai-benchmarksrecursive-self-improvementreward-hackingagent-frameworksGroundy Editorialhttps://groundy.com/articles/can-you-stitch-two-foundation-models-together-without-retraining/https://groundy.com/articles/can-you-stitch-two-foundation-models-together-without-retraining/Splicing layers from independently trained foundation models fails without targeted training at the join point. A two-stage recipe called Final Feature Matching makes it work.Fri, 05 Jun 2026 16:44:35 GMTGroundy Editorial2026-06-05T00:00:00.000Zmodel-stitchingfoundation-modelsvision-modelsmodel-mergingtransfer-learningrepresentation-learningGroundy Editorialhttps://groundy.com/articles/cloudflare-acquires-voidzero-the-company-behind-vites-rust-toolchain/https://groundy.com/articles/cloudflare-acquires-voidzero-the-company-behind-vites-rust-toolchain/Cloudflare acquired VoidZero, putting Vite, Rolldown, and Oxc maintainers on a deploy-target vendor's payroll. MIT licensing stays. Roadmap neutrality is the open question.Fri, 05 Jun 2026 16:08:31 GMTGroundy Editorial2026-06-05T00:00:00.000Zvitecloudflarevoidzeroopen-source-governancejavascript-toolingrolldownoxcGroundy Editorialhttps://groundy.com/articles/jailbreak-suffixes-hit-harder-at-specific-token-positions-new-gcg-variant-shows/https://groundy.com/articles/jailbreak-suffixes-hit-harder-at-specific-token-positions-new-gcg-variant-shows/SlotGCG shows adversarial token position, not just content, determines jailbreak success, with 14% higher attack rates and 42% higher rates against defended models.Fri, 05 Jun 2026 11:14:33 GMTGroundy Editorial2026-06-05T00:00:00.000Zjailbreakadversarial-attacksgcgllm-securityperplexity-filteringslotgcgGroundy Editorialhttps://groundy.com/articles/when-should-an-llm-forget-you-a-benchmark-for-deciding-what-memory-to-drop/https://groundy.com/articles/when-should-an-llm-forget-you-a-benchmark-for-deciding-what-memory-to-drop/PersistBench finds LLMs mishandle persistent memory 53 to 97 percent of the time. Unlearning suppresses rather than erases user data, making GDPR compliance unverifiable.Fri, 05 Jun 2026 11:08:22 GMTGroundy Editorial2026-06-05T00:00:00.000Zllm-memorymachine-unlearningpersistbenchgdpragent-safetydata-deletionGroundy Editorialhttps://groundy.com/articles/openai-adds-lockdown-mode-to-chatgpt-shifting-prompt-injection-risk-to-users/https://groundy.com/articles/openai-adds-lockdown-mode-to-chatgpt-shifting-prompt-injection-risk-to-users/OpenAI's Lockdown Mode disables agentic features builders rely on rather than fixing prompt injection at runtime, forcing a binary choice between security and capability.Fri, 05 Jun 2026 10:45:48 GMTGroundy Editorial2026-06-05T00:00:00.000Zprompt-injectionchatgptopenaisecurityagentic-workflowslockdown-modeGroundy Editorialhttps://groundy.com/articles/when-rl-training-rewards-capability-seeking-a-new-alignment-risk/https://groundy.com/articles/when-rl-training-rewards-capability-seeking-a-new-alignment-risk/A June 2026 ICML paper shows RL optimizers can push language models to exploit reward loopholes the task never required, while standard performance metrics hold steady.Fri, 05 Jun 2026 09:26:31 GMTGroundy Editorial2026-06-05T00:00:00.000Zrl-alignmentreward-hackingsafety-evaluationrlhfmodel-distillationinstrumental-convergenceGroundy Editorialhttps://groundy.com/articles/do-reasoning-llms-waste-tokens-ockbench-tries-to-measure/https://groundy.com/articles/do-reasoning-llms-waste-tokens-ockbench-tries-to-measure/OckBench scores 37 reasoning LLMs on token efficiency alongside accuracy, finding comparably accurate models differ by up to 26× in token cost under per-token billing.Fri, 05 Jun 2026 08:44:51 GMTGroundy Editorial2026-06-10T00:00:00.000Zockbenchllm-reasoningtoken-efficiencymodel-benchmarkinginference-costreasoning-modelsGroundy Editorialhttps://groundy.com/articles/activation-steering-was-sold-as-llm-control-new-work-makes-it-an-attack-surface/https://groundy.com/articles/activation-steering-was-sold-as-llm-control-new-work-makes-it-an-attack-surface/Poisoning 4-6% of tokens in a steering dataset silently inverts refusal vectors into jailbreaks, achieving 20-55% ASR. Shared vector bundles are the attack surface.Fri, 05 Jun 2026 08:43:48 GMTGroundy Editorial2026-06-05T00:00:00.000Zactivation-steeringjailbreaksupply-chain-securityllm-safetydata-poisoningrepresentation-engineeringGroundy Editorialhttps://groundy.com/articles/can-teaching-logical-fallacies-inoculate-people-against-ai-misinformation/https://groundy.com/articles/can-teaching-logical-fallacies-inoculate-people-against-ai-misinformation/An ACL 2026 study finds Socratic LLM tutoring teaches fallacy recognition better than bare LLMs, but whether those gains transfer to real misinformation is untested.Fri, 05 Jun 2026 08:09:08 GMTGroundy Editorial2026-06-05T00:00:00.000Zlogical-fallaciesmisinformationsocratic-methodai-educationacl-2026llm-tutoringGroundy Editorialhttps://groundy.com/articles/vercel-ships-experimental-native-cli-binaries-to-cut-the-node-startup-tax/https://groundy.com/articles/vercel-ships-experimental-native-cli-binaries-to-cut-the-node-startup-tax/Vercel's experimental native CLI binaries drop the Node.js runtime, targeting agent loops and CI pipelines that spawn vercel repeatedly and pay V8 startup cost on each call.Fri, 05 Jun 2026 07:33:34 GMTGroundy Editorial2026-06-05T00:00:00.000Zvercel-clinative-binariesnode-jsagent-loopsci-cddeveloper-toolsGroundy Editorialhttps://groundy.com/articles/catching-llm-agents-leaking-credentials-from-their-own-activations/https://groundy.com/articles/catching-llm-agents-leaking-credentials-from-their-own-activations/A new arXiv study shows credential leaks by LLM agents are detectable inside model activations before output tokens are generated, moving DLP upstream from text filtering.Fri, 05 Jun 2026 05:26:57 GMTGroundy Editorial2026-06-26T00:00:00.000Zcredential-exfiltrationllm-agentsactivation-probingagent-securitydata-loss-preventionmulti-turn-attacksGroundy Editorialhttps://groundy.com/articles/refusal-steering-targets-individual-experts-in-moe-llms/https://groundy.com/articles/refusal-steering-targets-individual-experts-in-moe-llms/Two papers show MoE refusal behavior concentrates in a handful of routing-controllable experts, letting anyone suppress safety scores by 41 points without retraining.Fri, 05 Jun 2026 05:06:28 GMTGroundy Editorial2026-06-05T00:00:00.000Zmoe-safetymodel-alignmentrefusal-steeringexpert-routingllm-auditingopen-weight-modelsGroundy Editorialhttps://groundy.com/articles/putting-a-datacenter-v100-in-a-gaming-pc-the-local-llm-math/https://groundy.com/articles/putting-a-datacenter-v100-in-a-gaming-pc-the-local-llm-math/A used V100 looks like cheap VRAM for local inference, but no bf16, no FlashAttention, and CUDA 13 deprecation lock buyers into a software stack that is actively contracting.Fri, 05 Jun 2026 04:10:09 GMTGroundy Editorial2026-06-05T00:00:00.000Zv100local-inferencenvidiacudagpu-hardwarevoltallm-inferenceGroundy Editorialhttps://groundy.com/articles/vercel-rebuilds-its-marketplace-cli-for-agents-instead-of-humans/https://groundy.com/articles/vercel-rebuilds-its-marketplace-cli-for-agents-instead-of-humans/Vercel's CLI now ships commands tuned for LLM callers, not human operators. The shift reveals how infrastructure tooling priorities invert when the primary caller is an agent.Fri, 05 Jun 2026 02:07:52 GMTGroundy Editorial2026-06-10T00:00:00.000Zcli-designvercelagent-toolingdeveloper-experiencellm-agentsinfrastructure-automationGroundy Editorialhttps://groundy.com/articles/the-2026-npm-attacks-proved-ai-coding-assistants-are-a-supply-chain-target/https://groundy.com/articles/the-2026-npm-attacks-proved-ai-coding-assistants-are-a-supply-chain-target/The 2026 npm supply-chain wave explicitly targeted AI coding assistants as privileged identities. Lockfiles and ignore-scripts stopped what SLSA provenance and OIDC could not.Fri, 05 Jun 2026 00:08:43 GMTGroundy Editorial2026-06-26T00:00:00.000Znpm-supply-chainai-coding-assistantsopen-source-securitypackage-managementdevsecopsmalwareGroundy Editorialhttps://groundy.com/articles/chatgpts-new-lockdown-mode-borrows-apples-name-for-a-prompt-injection-kill/https://groundy.com/articles/chatgpts-new-lockdown-mode-borrows-apples-name-for-a-prompt-injection-kill/OpenAI's ChatGPT Lockdown Mode disables web browsing, images, and Deep Research, conceding that model-level defenses against prompt injection have plateaued as of early 2026.Thu, 04 Jun 2026 23:49:43 GMTGroundy Editorial2026-06-04T00:00:00.000Zprompt-injectionchatgpt-securitylockdown-modeopenainetwork-exfiltrationenterprise-aiGroundy Editorialhttps://groundy.com/articles/when-mcp-tool-descriptions-dont-match-the-code-agents-trust-the-lie/https://groundy.com/articles/when-mcp-tool-descriptions-dont-match-the-code-agents-trust-the-lie/A study of 2,214 MCP servers finds 9.93% of tool descriptions diverge from the code, creating a confused-deputy risk for agent runtimes that select tools by description alone.Thu, 04 Jun 2026 20:19:01 GMTGroundy Editorial2026-06-04T00:00:00.000Zmcpagent-securitytool-description-inconsistencyconfused-deputydcicheckeragent-runtimesGroundy Editorialhttps://groundy.com/articles/students-are-prompt-injecting-ai-graders-to-score-full-marks/https://groundy.com/articles/students-are-prompt-injecting-ai-graders-to-score-full-marks/A June 2026 arXiv study finds that prompt injection in student submissions manipulates LLM grading systems into awarding full marks, and current defenses do not hold.Thu, 04 Jun 2026 19:36:10 GMTGroundy Editorial2026-06-04T00:00:00.000Zprompt-injectionllm-gradingai-educationacademic-integrityadversarial-inputllm-securityGroundy Editorialhttps://groundy.com/articles/malicious-npm-packages-hit-red-hats-published-javascript-clients/https://groundy.com/articles/malicious-npm-packages-hit-red-hats-published-javascript-clients/Malicious versions of 32 Red Hat npm packages carried a credential-stealing worm, published through the vendor's OIDC pipeline. Vendor namespaces are not a trust boundary.Thu, 04 Jun 2026 16:08:18 GMTGroundy Editorial2026-06-26T00:00:00.000Znpmsupply-chain-securityred-hatoidccredential-theftdependency-managementGroundy Editorialhttps://groundy.com/articles/stacked-org-policies-in-llm-chatbots-break-where-rules-collide/https://groundy.com/articles/stacked-org-policies-in-llm-chatbots-break-where-rules-collide/Stacking HR, legal, and brand policies in LLM prompts assumes additive compliance. Graph-based research finds per-rule testing misses combinatorial policy conflicts.Thu, 04 Jun 2026 13:13:43 GMTGroundy Editorial2026-06-04T00:00:00.000Zllm-guardrailspolicy-compositionenterprise-aicompliance-testingai-safetyai-governanceGroundy Editorialhttps://groundy.com/articles/removing-an-llm-backdoor-post-training-without-the-poisoned-data/https://groundy.com/articles/removing-an-llm-backdoor-post-training-without-the-poisoned-data/Patcher removes LLM backdoor triggers from a single observed failure and model weights, no poisoned training data required. Deployers gain an alternative to full retraining.Thu, 04 Jun 2026 11:34:38 GMTGroundy Editorial2026-06-04T00:00:00.000Zllm-backdoormodel-securitybackdoor-removalsupply-chainopen-weight-modelsadversarial-mlGroundy Editorialhttps://groundy.com/articles/which-layer-detects-llm-hallucinations-best-the-case-against-fixed-layer-probes/https://groundy.com/articles/which-layer-detects-llm-hallucinations-best-the-case-against-fixed-layer-probes/An ICML 2026 paper finds that fixed-layer hallucination probes miss detection signal, and proposes FEPoID, a training-free method to calibrate layer choice per model.Thu, 04 Jun 2026 10:09:05 GMTGroundy Editorial2026-06-04T00:00:00.000Zhallucination-detectionhidden-statesllm-probesintrinsic-dimensiontransformer-layersicml-2026Groundy Editorialhttps://groundy.com/articles/why-fine-tuning-strips-safety-alignment-from-open-weight-llms/https://groundy.com/articles/why-fine-tuning-strips-safety-alignment-from-open-weight-llms/Safety alignment in open-weight LLMs is concentrated in a handful of output tokens. Benign fine-tuning erases them, making release-time safety evaluations unreliable.Thu, 04 Jun 2026 09:12:25 GMTGroundy Editorial2026-06-26T00:00:00.000Zsafety-alignmentfine-tuningopen-weight-modelsllm-safetyreward-modelspactGroundy Editorialhttps://groundy.com/articles/stored-prompt-injection-now-persists-across-ai-agent-sessions/https://groundy.com/articles/stored-prompt-injection-now-persists-across-ai-agent-sessions/Prompt injection planted in one agent session resurfaces in later ones through persistent memory and tool state, bypassing input sanitization that only validates external.Thu, 04 Jun 2026 08:55:56 GMTGroundy Editorial2026-06-04T00:00:00.000Zprompt-injectionagent-securityllm-securityai-agentscross-session-attacksowaspGroundy Editorialhttps://groundy.com/articles/minimax-m3-bundles-1m-context-and-native-multimodal-into-one-open-weight-model/https://groundy.com/articles/minimax-m3-bundles-1m-context-and-native-multimodal-into-one-open-weight-model/MiniMax M3 bundles 1M context, multimodality, and frontier coding in one open-weight model at a tenth of Claude Opus 4.8. Open weights and license terms remain unconfirmed.Thu, 04 Jun 2026 07:11:42 GMTGroundy Editorial2026-06-10T00:00:00.000Zminimax-m3open-weight-modelssparse-attentionlong-contextllm-pricingmultimodal-aiGroundy Editorialhttps://groundy.com/articles/llm-data-poisoning-survives-the-data-cleaning-defenses-built-to-stop/https://groundy.com/articles/llm-data-poisoning-survives-the-data-cleaning-defenses-built-to-stop/The Phantom Transfer attack plants password-triggered backdoors into LLMs and survives all 11 tested data-level defenses, including full paraphrasing of every training sample.Thu, 04 Jun 2026 05:40:09 GMTGroundy Editorial2026-06-26T00:00:00.000Zdata-poisoningllm-securitybackdoor-attacksmodel-trainingweight-inspectiontraining-dataGroundy Editorialhttps://groundy.com/articles/openai-upgrades-codex-right-as-teams-weigh-leaving-claude-code/https://groundy.com/articles/openai-upgrades-codex-right-as-teams-weigh-leaving-claude-code/Codex CLI reaches 0.142.2 with a Claude Code /import path as OpenAI's free-months promo targets Claude Code teams, but Anthropic paused its June 15 billing change.Thu, 04 Jun 2026 04:57:42 GMTGroundy Editorial2026-06-26T00:00:00.000Zcodex-cliclaude-codeopenaianthropicswitching-costsenterprise-aicoding-assistantsGroundy Editorialhttps://groundy.com/articles/game-theory-vs-rlhf-modeling-llm-safety-alignment-as-a-non-cooperative-game/https://groundy.com/articles/game-theory-vs-rlhf-modeling-llm-safety-alignment-as-a-non-cooperative-game/AdvGame frames LLM safety as a co-evolutionary game between attacker and defender policies, so static certifications expire as adversarial strategies evolve.Thu, 04 Jun 2026 03:04:47 GMTGroundy Editorial2026-06-04T00:00:00.000Zllm-safetyrlhfgame-theoryadversarial-alignmentai-certificationsafety-evaluationGroundy Editorialhttps://groundy.com/articles/cost-aware-rag-routing-when-deeper-retrieval-stops-paying-off/https://groundy.com/articles/cost-aware-rag-routing-when-deeper-retrieval-stops-paying-off/CA-RAG shows fixed top-k wastes 26% of billed tokens on simple queries with no quality gain. Per-query routing changes RAG unit economics more than any embedding swap.Thu, 04 Jun 2026 01:56:08 GMTGroundy Editorial2026-06-04T00:00:00.000Zragretrieval-augmented-generationcost-optimizationquery-routingvector-searchinference-costtoken-billingGroundy Editorialhttps://groundy.com/articles/github-copilot-moves-to-a-platform-app-decoupling-from-the-editor/https://groundy.com/articles/github-copilot-moves-to-a-platform-app-decoupling-from-the-editor/GitHub's Copilot App anchors the AI assistant to the GitHub account rather than the editor, moving permission scope from per-developer to org-wide with agent merge authority.Wed, 03 Jun 2026 23:55:28 GMTGroundy Editorial2026-06-03T00:00:00.000Zgithub-copilotai-agentsaccess-controldeveloper-toolsci-cdprompt-injectionGroundy Editorialhttps://groundy.com/articles/using-your-nvidia-gpus-vram-as-linux-swap-where-the-nbd-hack-breaks-down/https://groundy.com/articles/using-your-nvidia-gpus-vram-as-linux-swap-where-the-nbd-hack-breaks-down/NBD-VRAM exposes GeForce VRAM as Linux swap, but PCIe latency and the zero-sum trade with GPU compute workloads make zram the stronger choice on most systems.Wed, 03 Jun 2026 23:39:41 GMTGroundy Editorial2026-06-26T00:00:00.000Znbd-vramvram-swaplinux-swapzrammemory-managementgpu-memoryGroundy Editorialhttps://groundy.com/articles/why-openai-bets-on-instruction-hierarchy-to-stop-prompt-injection/https://groundy.com/articles/why-openai-bets-on-instruction-hierarchy-to-stop-prompt-injection/OpenAI's instruction hierarchy improves TensorTrust scores to 0.94, not 1.0. The gap is probabilistic, not a protocol guarantee, and the burden falls on app builders.Wed, 03 Jun 2026 23:17:15 GMTGroundy Editorial2026-06-03T00:00:00.000Zprompt-injectioninstruction-hierarchyllm-securityopenaiagent-safetydefense-in-depthGroundy Editorialhttps://groundy.com/articles/explainability-mandates-leak-graph-models-to-their-attackers/https://groundy.com/articles/explainability-mandates-leak-graph-models-to-their-attackers/Feature-attribution explanations that satisfy transparency rules leak enough decision logic to let attackers reconstruct graph neural networks without querying model weights.Wed, 03 Jun 2026 22:56:55 GMTGroundy Editorial2026-06-03T00:00:00.000Zgraph-neural-networksmodel-extractionexplainabilityai-securityeu-ai-actcomplianceGroundy Editorialhttps://groundy.com/articles/stopping-multi-turn-llm-jailbreaks-without-retraining-the-model/https://groundy.com/articles/stopping-multi-turn-llm-jailbreaks-without-retraining-the-model/THRD is a training-free defense against multi-turn LLM jailbreaks that runs entirely at inference time, cutting attack success to 0.2-4.0% without modifying model weights.Wed, 03 Jun 2026 21:20:20 GMTGroundy Editorial2026-06-03T00:00:00.000Zllm-safetyjailbreak-defenseinference-timemulti-turn-attacksai-securityadversarial-robustnessGroundy Editorialhttps://groundy.com/articles/african-languages-are-a-jailbreak-blind-spot-for-english-tuned-llm-safety/https://groundy.com/articles/african-languages-are-a-jailbreak-blind-spot-for-english-tuned-llm-safety/TukaBench extends JailbreakBench to seven African languages and finds English safety alignment fails to transfer. Culturally adapted prompts widen the gap for deployers.Wed, 03 Jun 2026 20:37:20 GMTGroundy Editorial2026-06-03T00:00:00.000Zllm-safetymultilingual-aijailbreakred-teamingafrican-languagesai-alignmentGroundy Editorialhttps://groundy.com/articles/how-a-vscode-bug-let-one-click-steal-your-github-token/https://groundy.com/articles/how-a-vscode-bug-let-one-click-steal-your-github-token/A four-step exploit chain in github.dev steals full-scope GitHub OAuth tokens via a single link click, exposing every repo the victim can reach with no patch available.Wed, 03 Jun 2026 20:02:24 GMTGroundy Editorial2026-06-03T00:00:00.000Zvscode-securitygithub-oauthtoken-theftwebview-exploitci-cd-securitygithub-devGroundy Editorialhttps://groundy.com/articles/when-an-ai-agent-causes-a-loss-who-files-the-insurance-claim/https://groundy.com/articles/when-an-ai-agent-causes-a-loss-who-files-the-insurance-claim/The CER framework argues AI agent losses need state reconstruction to be insurable. Logging decisions today decide whether a future agent failure is covered or goes uninsured.Wed, 03 Jun 2026 19:02:09 GMTGroundy Editorial2026-06-03T00:00:00.000Zai-agentsinsurancecer-frameworkai-liabilityauditabilityeu-ai-actGroundy Editorialhttps://groundy.com/articles/cross-domain-rl-training-degrades-capabilities-care-rl-reweights-to-fix/https://groundy.com/articles/cross-domain-rl-training-degrades-capabilities-care-rl-reweights-to-fix/CARE-RL shows that pooling math, code, and chat into one RL run causes silent capability erosion across domains, and proposes gradient subspace projection to reweight updates.Wed, 03 Jun 2026 18:17:35 GMTGroundy Editorial2026-06-26T00:00:00.000Zreinforcement-learningmulti-domain-trainingcapability-interferencegradient-editingllm-post-trainingreward-signal-designGroundy Editorialhttps://groundy.com/articles/when-agent-skill-libraries-scale-dependency-aware-retrieval-beats-flat-search/https://groundy.com/articles/when-agent-skill-libraries-scale-dependency-aware-retrieval-beats-flat-search/Graph-of-Skills treats skill retrieval as dependency-graph traversal, cutting inference tokens 56% and improving task reward 25% over flat embedding search.Wed, 03 Jun 2026 17:40:05 GMTGroundy Editorial2026-06-10T00:00:00.000Zskill-retrievaldependency-graphsagent-frameworksinference-costtool-registriesragmcpGroundy Editorialhttps://groundy.com/articles/evolutionary-search-finds-llm-jailbreak-classes-that-static-red-teaming-misses/https://groundy.com/articles/evolutionary-search-finds-llm-jailbreak-classes-that-static-red-teaming-misses/MAP-Elites evolution finds distinct jailbreak classes across four LLMs, showing that static safety benchmarks leave unmeasured coverage gaps in vendor certifications.Wed, 03 Jun 2026 16:47:48 GMTGroundy Editorial2026-06-10T00:00:00.000Zllm-red-teamingadversarial-attacksllm-safetyquality-diversitymap-elitessafety-evaluationGroundy Editorialhttps://groundy.com/articles/poisoning-open-source-llm-merges-one-bad-checkpoint-hijacks-the-result/https://groundy.com/articles/poisoning-open-source-llm-merges-one-bad-checkpoint-hijacks-the-result/RogueMerge shows a single poisoned task vector survives six merge algorithms across 170+ LLMs, breaking the assumption that merging dilutes adversarial influence.Wed, 03 Jun 2026 16:02:00 GMTGroundy Editorial2026-06-03T00:00:00.000Zllm-mergingmodel-securityadversarial-attackssupply-chainopen-source-llmsbackdoor-attacksGroundy Editorialhttps://groundy.com/articles/can-instruction-tuned-retrievers-fix-agentic-searchs-retrieval-gap/https://groundy.com/articles/can-instruction-tuned-retrievers-fix-agentic-searchs-retrieval-gap/Critic-R adds a natural-language critic between retrieval and generation in agentic search, rewriting queries when fetched context fails to support the next reasoning step.Wed, 03 Jun 2026 15:40:47 GMTGroundy Editorial2026-06-03T00:00:00.000Zragagentic-searchquery-rewritingmulti-hop-qaretrieval-optimizationinstruction-tuned-retrieversGroundy Editorialhttps://groundy.com/articles/llm-watermarking-without-quality-loss-the-non-distortionary-approach/https://groundy.com/articles/llm-watermarking-without-quality-loss-the-non-distortionary-approach/LUNA's POS-adaptive watermark claims AUROC 0.9959 with 0.045 perplexity shift across six languages, but paraphrase robustness remains untested for all distortion-free schemes.Wed, 03 Jun 2026 14:51:29 GMTGroundy Editorial2026-06-03T00:00:00.000Zllm-watermarkingai-content-detectionprovenance-trackingtext-generationnlp-researchmultilingual-nlpGroundy Editorialhttps://groundy.com/articles/an-autonomous-research-agent-now-discovers-sota-llm-jailbreak-attacks/https://groundy.com/articles/an-autonomous-research-agent-now-discovers-sota-llm-jailbreak-attacks/Claudini's autonomous loop designs jailbreak algorithms hitting 80% ASR on GPT-OSS-Safeguard and 100% on Meta-SecAlign-70B. Attack discovery now costs a compute run.Wed, 03 Jun 2026 14:02:38 GMTGroundy Editorial2026-06-03T00:00:00.000Zllm-jailbreakadversarial-attacksai-safetyautomated-red-teamingllm-securityautonomous-agentsGroundy Editorialhttps://groundy.com/articles/github-copilot-and-productivity-what-an-observational-dose-response-study/https://groundy.com/articles/github-copilot-and-productivity-what-an-observational-dose-response-study/Observational Copilot-productivity studies measure who uses the tool, not what the tool causes. Selection bias makes every dose-response claim uninterpretable without.Wed, 03 Jun 2026 13:32:18 GMTGroundy Editorial2026-06-03T00:00:00.000Zgithub-copilotproductivity-measurementobservational-studiesselection-biasai-code-assistantscausal-inferenceGroundy Editorialhttps://groundy.com/articles/why-ai-red-teaming-rediscovers-the-same-jailbreaks-and-misses-the-rest/https://groundy.com/articles/why-ai-red-teaming-rediscovers-the-same-jailbreaks-and-misses-the-rest/Stable-GFlowNet, an ICML 2026 Spotlight paper, shows that automated LLM red-teamers mode-collapse onto narrow jailbreaks, leaving safety audits blind to wide attack regions.Wed, 03 Jun 2026 12:33:45 GMTGroundy Editorial2026-06-03T00:00:00.000Zred-teamingllm-safetyjailbreak-diversitygenerative-flow-networksai-safety-auditmode-collapseGroundy Editorialhttps://groundy.com/articles/morningstars-780b-spacex-mark-undercuts-the-ipo-target-by-half/https://groundy.com/articles/morningstars-780b-spacex-mark-undercuts-the-ipo-target-by-half/Morningstar's DCF pegs SpaceX at $780 billion, $970 billion below the IPO target, revealing how insider-priced private marks diverge from independent valuation.Wed, 03 Jun 2026 11:44:33 GMTGroundy Editorial2026-06-26T00:00:00.000Zspacex-ipomorningstar-valuationprivate-market-valuationstarlinkxaipre-ipodcf-modelGroundy Editorialhttps://groundy.com/articles/malware-can-prompt-inject-the-ai-agent-reverse-engineering/https://groundy.com/articles/malware-can-prompt-inject-the-ai-agent-reverse-engineering/Decompiled malware strings can prompt-inject LLM agents used for triage. Defenses fail over 85% of the time, and formal analysis argues the problem is structurally unsolvable.Wed, 03 Jun 2026 11:06:09 GMTGroundy Editorial2026-06-03T00:00:00.000Zprompt-injectionmalware-analysisllm-agentsreverse-engineeringadversarial-mlcyber-securityGroundy Editorialhttps://groundy.com/articles/bandit-based-prompt-optimization-targets-multi-agent-systems-like-crewai/https://groundy.com/articles/bandit-based-prompt-optimization-targets-multi-agent-systems-like-crewai/MASPOB automates per-agent prompt tuning in multi-agent systems using bandit search over GNN embeddings, but rollout convergence cost is the gating factor for practitioners.Wed, 03 Jun 2026 10:33:26 GMTGroundy Editorial2026-06-03T00:00:00.000Zmulti-agent-systemsprompt-optimizationbandit-algorithmsgraph-neural-networkscrewaiautogenGroundy Editorialhttps://groundy.com/articles/cve-factory-turns-published-cves-into-security-agent-training-data-a-32b-model/https://groundy.com/articles/cve-factory-turns-published-cves-into-security-agent-training-data-a-32b-model/CVE-Factory reproduces known CVEs at 66% verified accuracy. A 32B model trained on its traces beats Claude 4.5 Sonnet, commoditizing offensive security expertise.Wed, 03 Jun 2026 09:54:40 GMTGroundy Editorial2026-06-10T00:00:00.000Zvulnerability-reproductionsecurity-agentscve-benchmarksmodel-fine-tuningopen-source-securityoffensive-securityGroundy Editorialhttps://groundy.com/articles/open-source-workspace-suite-tinycld-takes-on-google-and-nextcloud/https://groundy.com/articles/open-source-workspace-suite-tinycld-takes-on-google-and-nextcloud/TinyCld bundles mail, calendar, drive, docs, and spreadsheets into one self-hosted container. Whether it replaces Google Workspace depends entirely on email deliverability.Tue, 02 Jun 2026 21:08:07 GMTGroundy Editorial2026-06-26T00:00:00.000Ztinycldself-hostedproductivity-suiteemail-deliverabilitydockernextcloudopen-sourceGroundy Editorialhttps://groundy.com/articles/darpas-aixcc-postmortem-what-autonomous-cyber-reasoning-systems-got-right/https://groundy.com/articles/darpas-aixcc-postmortem-what-autonomous-cyber-reasoning-systems-got-right/A USENIX Security 2026 SoK paper dissects DARPA's AIxCC cyber reasoning systems, which found 77% of synthetic bugs but proved unusable outside their competition sandboxes.Tue, 02 Jun 2026 20:29:00 GMTGroundy Editorial2026-06-03T00:00:00.000Zdarpa-aixccautonomous-patchingvulnerability-discoverycyber-reasoningoss-securityllm-securityGroundy Editorialhttps://groundy.com/articles/an-open-source-home-camera-that-encrypts-end-to-end-instead-of-trusting-ring/https://groundy.com/articles/an-open-source-home-camera-that-encrypts-end-to-end-instead-of-trusting-ring/Secluso is a GPLv3 camera system that encrypts footage on a Raspberry Pi so the relay server cannot read it. Key management, hosting, and hardware limits fall to the operator.Tue, 02 Jun 2026 19:44:09 GMTGroundy Editorial2026-06-26T00:00:00.000Zend-to-end-encryptionhome-security-cameraraspberry-piopen-sourceprivacyself-hostedGroundy Editorialhttps://groundy.com/articles/llms-treat-the-assistant-persona-as-privileged-thats-a-safety-gap/https://groundy.com/articles/llms-treat-the-assistant-persona-as-privileged-thats-a-safety-gap/A paper on Llama-3.1-70B finds the Assistant persona is its sole self-recognition reference, opening a persona-spoofing threat vector content-scanning defenses cannot catch.Tue, 02 Jun 2026 18:53:43 GMTGroundy Editorial2026-06-03T00:00:00.000Zllm-self-recognitionpersona-privilegellm-safetyjailbreak-defensealignment-researchactivation-spaceGroundy Editorialhttps://groundy.com/articles/vercels-grep-buy-signals-code-search-is-now-ai-agent-infrastructure/https://groundy.com/articles/vercels-grep-buy-signals-code-search-is-now-ai-agent-infrastructure/Vercel put Grep's founder on its AI team. The deal turns code search into a retrieval layer for AI agents, pressuring standalone tools into the hosting bundle.Tue, 02 Jun 2026 17:58:40 GMTGroundy Editorial2026-06-10T00:00:00.000Zvercelcode-searchai-agentsmcpdeveloper-toolsai-infrastructureGroundy Editorialhttps://groundy.com/articles/llm-reasoning-traces-leak-the-private-data-theyre-told-to-hide/https://groundy.com/articles/llm-reasoning-traces-leak-the-private-data-theyre-told-to-hide/Reasoning models embed sensitive data in chain-of-thought traces omitted from final answers, creating a privacy gap that output-level safety training cannot address.Tue, 02 Jun 2026 17:17:56 GMTGroundy Editorial2026-06-02T00:00:00.000Zchain-of-thoughtprivacyprompt-injectionllm-safetyreasoning-modelsdata-leakagemodel-deploymentGroundy Editorialhttps://groundy.com/articles/treating-llm-agent-memory-as-a-database-the-vikingmem-approach/https://groundy.com/articles/treating-llm-agent-memory-as-a-database-the-vikingmem-approach/VikingMem treats LLM agent memory as a database with events, entities, and temporal compression, reporting up to 30% better retrieval than current approaches.Tue, 02 Jun 2026 16:32:05 GMTGroundy Editorial2026-06-26T00:00:00.000Zllm-agentsagent-memoryvikingmemvector-databasesmemory-managementvldb-2026Groundy Editorialhttps://groundy.com/articles/your-open-source-license-wont-stop-someone-phishing-with-your-code/https://groundy.com/articles/your-open-source-license-wont-stop-someone-phishing-with-your-code/The Axios attack exposed that permissive licenses grant irrevocable, abuse-blind rights, forcing maintainers to rely on trademark policy and registry takedowns.Tue, 02 Jun 2026 16:05:03 GMTGroundy Editorial2026-06-02T00:00:00.000Zopen-source-licensingsupply-chain-securitynpmmit-licensephishingtrademarkGroundy Editorialhttps://groundy.com/articles/can-a-language-model-work-without-a-neural-network-a-new-arxiv-paper-says-yes/https://groundy.com/articles/can-a-language-model-work-without-a-neural-network-a-new-arxiv-paper-says-yes/A single-author arXiv preprint claims an RBF-network variant can build a language model without backpropagation-trained deep nets, solving for global loss optimum in one step.Tue, 02 Jun 2026 15:03:29 GMTGroundy Editorial2026-06-26T00:00:00.000Zrbf-networkslanguage-modelstransformer-alternativesarxivmachine-learning-architecturebackpropagationGroundy Editorialhttps://groundy.com/articles/can-code-generating-llms-do-engineering-math-fem-bench-tests-them/https://groundy.com/articles/can-code-generating-llms-do-engineering-math-fem-bench-tests-them/FEM-Bench tests 33 finite element tasks and finds Gemini 3 Pro solved 30 in five attempts. The risk: LLM solvers that compile and run but return physically wrong results.Tue, 02 Jun 2026 14:22:58 GMTGroundy Editorial2026-06-02T00:00:00.000Zfem-benchcode-generationllm-benchmarksfinite-element-methodscientific-computingllm-evaluationGroundy Editorialhttps://groundy.com/articles/newer-llms-arent-always-safer-adversarial-attacks-transfer-across-model/https://groundy.com/articles/newer-llms-arent-always-safer-adversarial-attacks-transfer-across-model/Gemma 3 is more vulnerable to adversarial attacks than Gemma 2, with misinformation rates leaping from 29% to 99%. Safety does not reliably accumulate across model releases.Tue, 02 Jun 2026 13:36:02 GMTGroundy Editorial2026-06-26T00:00:00.000Zadversarial-attacksllm-safetysafety-alignmentred-teamingmodel-evaluationjailbreak-transferGroundy Editorialhttps://groundy.com/articles/unlearning-isnt-deletion-arxiv-2505-16831-shows-machine-unlearning-in-llms/https://groundy.com/articles/unlearning-isnt-deletion-arxiv-2505-16831-shows-machine-unlearning-in-llms/Two independent studies confirm machine unlearning methods suppress outputs without erasing internal representations, making GDPR compliance claims unverifiable.Tue, 02 Jun 2026 12:36:09 GMTGroundy Editorial2026-06-02T00:00:00.000Zmachine-unlearningllm-securitygdpr-compliancemodel-representationai-safetydata-privacyGroundy Editorialhttps://groundy.com/articles/video-jailbreaks-hit-multimodal-llms-by-splitting-payloads-across-clips/https://groundy.com/articles/video-jailbreaks-hit-multimodal-llms-by-splitting-payloads-across-clips/Splitting harmful requests across benign video clips defeats per-frame moderation on eight multimodal LLMs, forcing safety teams to invest in cross-clip semantic reasoning.Tue, 02 Jun 2026 11:57:18 GMTGroundy Editorial2026-06-02T00:00:00.000Zvideo-jailbreakmultimodal-safetycontent-moderationadversarial-attacksmllmvideo-modalityGroundy Editorialhttps://groundy.com/articles/ombs-power-to-cancel-any-grant-at-any-time-shifts-risk-onto-university-ai-labs/https://groundy.com/articles/ombs-power-to-cancel-any-grant-at-any-time-shifts-risk-onto-university-ai-labs/A proposed OMB rule would let agencies cancel any federal grant at will. For AI labs, multi-year projects lose their funding certainty with no hedge against cancellation risk.Tue, 02 Jun 2026 11:04:19 GMTGroundy Editorial2026-06-02T00:00:00.000Zfederal-grantsomb-ruleai-researchgrant-cancellationuniversity-labsresearch-fundingGroundy Editorialhttps://groundy.com/articles/jetbrains-ships-codex-natively-making-its-ide-the-multi-vendor-ai-surface/https://groundy.com/articles/jetbrains-ships-codex-natively-making-its-ide-the-multi-vendor-ai-surface/JetBrains ships Codex natively in its IDEs alongside Claude, Gemini, and local models, making the editor a model-agnostic AI procurement surface for IDE-standardized teams.Tue, 02 Jun 2026 10:25:06 GMTGroundy Editorial2026-06-26T00:00:00.000Zjetbrainsopenai-codexai-code-assistantide-integrationmulti-model-aideveloper-toolsGroundy Editorialhttps://groundy.com/articles/anthropics-965b-private-mark-now-faces-a-confidential/https://groundy.com/articles/anthropics-965b-private-mark-now-faces-a-confidential/Anthropic's $965B Series H valuation faces its first public test after a confidential S-1 filing four days later. SEC disclosure will reveal if the revenue multiple holds.Tue, 02 Jun 2026 09:47:02 GMTGroundy Editorial2026-06-02T00:00:00.000Zanthropiciposeries-hai-valuations1-filingfrontier-modelsGroundy Editorialhttps://groundy.com/articles/why-llms-fail-at-spatial-reasoning-when-planning-navigation/https://groundy.com/articles/why-llms-fail-at-spatial-reasoning-when-planning-navigation/LLMs fail at spatial navigation because training text encodes geometry poorly. Two papers show explicit structural scaffolding, not prompt tweaks, is the fix teams need.Mon, 01 Jun 2026 21:05:13 GMTGroundy Editorial2026-06-02T00:00:00.000Zspatial-reasoningllm-navigationinductive-biasembodied-agentssearch-treestraining-data-biasGroundy Editorialhttps://groundy.com/articles/ranking-llms-side-by-side-makes-their-dialect-bias-worse/https://groundy.com/articles/ranking-llms-side-by-side-makes-their-dialect-bias-worse/A FAccT 2026 study finds pairwise LLM evaluation, the format behind chatbot arenas and RLHF, amplifies bias against AAVE, and dialect labels make the problem worse.Mon, 01 Jun 2026 19:52:07 GMTGroundy Editorial2026-06-02T00:00:00.000Zllm-evaluationdialect-biasaaverlhffairnesschatbot-arenasGroundy Editorialhttps://groundy.com/articles/vercel-ai-sdk-cve-2025-48985-input-validation-bypass-hits-llm-app-builders/https://groundy.com/articles/vercel-ai-sdk-cve-2025-48985-input-validation-bypass-hits-llm-app-builders/An index mismatch in Vercel AI SDK lets attackers inject arbitrary bytes into prompt file inputs. With no NVD CVSS score yet, most dependency scanners will not flag it.Mon, 01 Jun 2026 19:15:55 GMTGroundy Editorial2026-06-02T00:00:00.000Zcveai-sdkinput-validationsupply-chainllm-securitydependency-managementGroundy Editorialhttps://groundy.com/articles/can-synthetic-preference-data-keep-rlhf-private-without-wrecking-alignment/https://groundy.com/articles/can-synthetic-preference-data-keep-rlhf-private-without-wrecking-alignment/DPPrefSyn generates synthetic preference pairs under differential privacy so annotator data stays out of alignment training. No results at strict epsilon budgets are public.Mon, 01 Jun 2026 17:45:55 GMTGroundy Editorial2026-06-02T00:00:00.000Zdifferential-privacyrlhfllm-alignmentgdprsynthetic-datapreference-learningGroundy Editorialhttps://groundy.com/articles/what-breaks-when-claude-code-writes-production-code-a-new-failure-catalog/https://groundy.com/articles/what-breaks-when-claude-code-writes-production-code-a-new-failure-catalog/A 547-incident taxonomy finds coding agents' worst failures emerge during routine tasks, not adversarial attacks. Tests miss them entirely, requiring runtime sandboxing.Mon, 01 Jun 2026 16:53:07 GMTGroundy Editorial2026-06-02T00:00:00.000Zagentic-codingcoding-agentsai-safetyprompt-injectionsoftware-engineeringllm-reliabilityGroundy Editorialhttps://groundy.com/articles/hijacking-ai-agent-memory-one-conversation-can-plant-a-persistent-trojan/https://groundy.com/articles/hijacking-ai-agent-memory-one-conversation-can-plant-a-persistent-trojan/MemPoison plants a persistent trojan in AI agent memory through ordinary conversation, defeating extraction and rewriting pipelines with up to 95% attack success.Mon, 01 Jun 2026 15:54:38 GMTGroundy Editorial2026-06-02T00:00:00.000Zagent-memorymemory-poisoningadversarial-attacksllm-securityembedding-attackspersistent-memoryGroundy Editorialhttps://groundy.com/articles/why-attack-success-rate-misleads-llm-jailbreak-benchmarks/https://groundy.com/articles/why-attack-success-rate-misleads-llm-jailbreak-benchmarks/The ASR metric behind every jailbreak leaderboard collapses distinct safety failures into one number, so models with the same score can fail in completely different ways.Mon, 01 Jun 2026 15:07:36 GMTGroundy Editorial2026-06-26T00:00:00.000Zllm-safetyjailbreak-benchmarksattack-success-ratetemporal-logit-observabilityllm-evaluationred-teamingGroundy Editorialhttps://groundy.com/articles/more-agents-worse-results-why-multi-agent-llm-teams-hold-experts-back/https://groundy.com/articles/more-agents-worse-results-why-multi-agent-llm-teams-hold-experts-back/ICML 2026 research shows LLM teams lose 6 to 41 percentage points versus their best member. Three studies agree: multi-agent consensus drags the expert down.Mon, 01 Jun 2026 13:49:10 GMTGroundy Editorial2026-06-02T00:00:00.000Zmulti-agent-systemsllm-performanceai-agentsconsensusllm-benchmarksagent-orchestrationGroundy Editorialhttps://groundy.com/articles/transformers-js-v4-moves-transformer-inference-into-the-browser/https://groundy.com/articles/transformers-js-v4-moves-transformer-inference-into-the-browser/Transformers.js v4 ships a C++ WebGPU runtime with 4x BERT speedups, letting teams move small classification and embedding jobs from server GPUs to the browser.Mon, 01 Jun 2026 12:51:37 GMTGroundy Editorial2026-06-02T00:00:00.000Zwebgputransformers-jsbrowser-inferenceonnx-runtimeedge-deploymenthugging-facejavascript-mlGroundy Editorialhttps://groundy.com/articles/openrouters-113m-series-b-bets-routing-beats-picking-a-single-llm/https://groundy.com/articles/openrouters-113m-series-b-bets-routing-beats-picking-a-single-llm/OpenRouter's $113M round at $1.3B bets routing beats model loyalty. If routers capture the pricing spread, vendor lock-in carries a measurable cost premium.Mon, 01 Jun 2026 12:15:37 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-routingopenrouterllm-infrastructureventure-capitalapi-middlewarevendor-lock-inGroundy Editorialhttps://groundy.com/articles/does-giving-ai-agents-more-skills-help-a-controlled-skillsbench-study/https://groundy.com/articles/does-giving-ai-agents-more-skills-help-a-controlled-skillsbench-study/SkillsBench study: curated skills lift agent pass rates 18 to 36 pp, while documentation granularity shifts outcomes under 1 pp. Curation, not polish, is the bottleneck.Mon, 01 Jun 2026 10:49:42 GMTGroundy Editorial2026-06-02T00:00:00.000Zagent-skillsllm-benchmarksskillsbenchai-agentsmodel-evaluationskill-catalogsGroundy Editorialhttps://groundy.com/articles/ftcs-may-11-take-it-down-act-letters-set-may-19-deadline-48-hour-removal-53-088/https://groundy.com/articles/ftcs-may-11-take-it-down-act-letters-set-may-19-deadline-48-hour-removal-53-088/The FTC's Take It Down Act enforcement is live. Platforms face $53,088 per violation for failing to remove nonconsensual intimate imagery within 48 hours of a valid request.Mon, 01 Jun 2026 09:52:05 GMTGroundy Editorial2026-06-02T00:00:00.000Ztake-it-down-actftcnonconsensual-imagerydeepfakescontent-moderationplatform-regulationGroundy Editorialhttps://groundy.com/articles/replacing-workers-with-ai-erodes-the-skills-youll-need-later/https://groundy.com/articles/replacing-workers-with-ai-erodes-the-skills-youll-need-later/Replacing junior roles with AI tools masks a hidden cost: the erosion of senior-level skills needed to verify, correct, and supervise those same systems over time.Sun, 31 May 2026 20:57:53 GMTGroundy Editorial2026-06-02T00:00:00.000Zai-automationcapability-erosionworkforce-skillsai-labor-substitutionorganizational-capabilityjunior-pipelineGroundy Editorialhttps://groundy.com/articles/does-ai-have-6-5-years-before-it-breaches-a-planetary-boundary/https://groundy.com/articles/does-ai-have-6-5-years-before-it-breaches-a-planetary-boundary/A preprint assigns AI a planetary boundary with a 6.5-year breach window, but the countdown excludes AI's thermal load and a rival roadmap targets 1000× efficiency gains.Sun, 31 May 2026 19:45:38 GMTGroundy Editorial2026-06-26T00:00:00.000Zai-energyplanetary-boundarieswaste-heatdatacenter-energyai-efficiencyclimate-policyGroundy Editorialhttps://groundy.com/articles/can-a-mental-health-support-chatbot-be-safe-if-it-learns-from-forums/https://groundy.com/articles/can-a-mental-health-support-chatbot-be-safe-if-it-learns-from-forums/LLUMI matches GPT empathy scores by training on Reddit upvotes, but its safety evaluations lack clinical credentials, shifting liability to any platform that deploys it.Sun, 31 May 2026 18:47:44 GMTGroundy Editorial2026-06-02T00:00:00.000Zmental-health-aimodel-safetyclinical-validationai-liabilitydpoopen-source-llmreddit-training-dataGroundy Editorialhttps://groundy.com/articles/dataset-watermarks-fail-to-trace-fine-tuned-ai-image-models-new-benchmark-finds/https://groundy.com/articles/dataset-watermarks-fail-to-trace-fine-tuned-ai-image-models-new-benchmark-finds/A new benchmark finds dataset watermarks can be stripped from fine-tuned diffusion models without quality loss, undermining post-hoc traceability as a regulatory mechanism.Sun, 31 May 2026 17:31:53 GMTGroundy Editorial2026-06-02T00:00:00.000Zdataset-watermarkingdiffusion-modelsai-provenancec2pawatermark-removalai-regulationGroundy Editorialhttps://groundy.com/articles/can-llm-agents-realistically-fake-reactions-to-online-news/https://groundy.com/articles/can-llm-agents-realistically-fake-reactions-to-online-news/A matched study of 58,555 real and synthetic news reactions finds LLM replies plausible individually but distributionally distant, pressuring platform detection tooling.Sun, 31 May 2026 16:20:48 GMTGroundy Editorial2026-06-02T00:00:00.000Zllm-agentsastroturfingbot-detectionsynthetic-contenttrust-and-safetyfine-tuningGroundy Editorialhttps://groundy.com/articles/job-seekers-are-prompt-injecting-ai-resume-screeners-new-study-measures-the-hit/https://groundy.com/articles/job-seekers-are-prompt-injecting-ai-resume-screeners-new-study-measures-the-hit/A USENIX Security 2026 study of 200K real resumes found 1% contain hidden prompt injections, with 90% stuffing invisible keywords rather than manipulating LLM instructions.Sun, 31 May 2026 15:48:34 GMTGroundy Editorial2026-06-02T00:00:00.000Zprompt-injectionresume-screeningllm-securityhiring-techadversarial-attacksats-vendorsGroundy Editorialhttps://groundy.com/articles/why-audio-jailbreaks-slip-past-the-safety-training-built-for-text-llms/https://groundy.com/articles/why-audio-jailbreaks-slip-past-the-safety-training-built-for-text-llms/A taxonomy of audio jailbreak attacks reveals four surfaces text-trained guardrails never cover, forcing voice-interface vendors to red-team each modality separately.Sun, 31 May 2026 14:25:30 GMTGroundy Editorial2026-06-02T00:00:00.000Zaudio-jailbreaksllm-safetymultimodal-alignmentadversarial-attacksvoice-interfacesmodel-securityGroundy Editorialhttps://groundy.com/articles/can-an-llm-peer-review-your-paper-a-new-behavior-benchmark/https://groundy.com/articles/can-an-llm-peer-review-your-paper-a-new-behavior-benchmark/PRAIB benchmarks LLM-generated peer reviews across 11,000 reviews on 1,000 papers, finding positive bias, compressed variance, and systematically overlooked weaknesses.Sun, 31 May 2026 13:26:57 GMTGroundy Editorial2026-06-02T00:00:00.000Zpeer-reviewllm-benchmarkai-peer-reviewresearch-integrityconference-reviewllm-biasGroundy Editorialhttps://groundy.com/articles/lora-adapter-backdoors-generalize-beyond-their-trigger-tokens/https://groundy.com/articles/lora-adapter-backdoors-generalize-beyond-their-trigger-tokens/A LoRA adapter backdoor generalizes across token neighborhoods beyond the trained trigger, making behavioral probing mandatory for teams consuming community fine-tunes.Sun, 31 May 2026 12:07:26 GMTGroundy Editorial2026-06-02T00:00:00.000Zlora-adaptersbackdoor-detectionsupply-chain-securityllm-fine-tuningtoken-generalizationbehavioral-probingGroundy Editorialhttps://groundy.com/articles/cloudflare-turnstile-now-fingerprints-webgl-the-privacy-captcha-tradeoff/https://groundy.com/articles/cloudflare-turnstile-now-fingerprints-webgl-the-privacy-captcha-tradeoff/A researcher found Cloudflare Turnstile now demands fingerprintable WebGL to pass challenges, contradicting its privacy policy that lists only IP, TLS, and User-Agent signals.Sun, 31 May 2026 11:14:13 GMTGroundy Editorial2026-06-02T00:00:00.000Zcloudflare-turnstilewebglbrowser-fingerprintingcaptchaweb-privacybot-detectionGroundy Editorialhttps://groundy.com/articles/anthropic-scaled-sparse-autoencoders-to-claude-3-sonnet-interpretability-now/https://groundy.com/articles/anthropic-scaled-sparse-autoencoders-to-claude-3-sonnet-interpretability-now/Anthropic extracted 34M interpretable features from Claude 3 Sonnet, proving sparse autoencoders work on production models. Interpretability now has its own compute budget.Sun, 31 May 2026 10:23:06 GMTGroundy Editorial2026-06-10T00:00:00.000Zsparse-autoencodersmechanistic-interpretabilityclaude-3-sonnetai-safetydictionary-learninganthropicGroundy Editorialhttps://groundy.com/articles/an-open-source-80386-rebuilt-around-intels-original-microcode/https://groundy.com/articles/an-open-source-80386-rebuilt-around-intels-original-microcode/z386 is an 80386 FPGA core driven by Intel's original microcode ROM, recovered from die photographs. It runs Doom at 16.5 FPS, but the microcode's IP status is unresolved.Sat, 30 May 2026 18:41:00 GMTGroundy Editorial2026-06-02T00:00:00.000Zfpgaretrocomputing80386microcodeopen-source-hardwareintellectual-propertyGroundy Editorialhttps://groundy.com/articles/valves-200-steam-deck-price-hike-concedes-the-handheld-pc-margin-squeeze/https://groundy.com/articles/valves-200-steam-deck-price-hike-concedes-the-handheld-pc-margin-squeeze/Valve's 43% Steam Deck price hike signals DRAM shortages and tariff pressure have outrun the subsidized-hardware model that anchored the entire handheld PC category.Sat, 30 May 2026 12:55:21 GMTGroundy Editorial2026-06-02T00:00:00.000Zsteam-deckhandheld-pcdram-shortagevalvehardware-pricingconsumer-electronicsGroundy Editorialhttps://groundy.com/articles/can-llm-personas-replace-human-survey-respondents-new-arxiv-paper-tests/https://groundy.com/articles/can-llm-personas-replace-human-survey-respondents-new-arxiv-paper-tests/Two 2026 studies reach opposite conclusions on LLM survey simulation. Static prompting distorts minority subgroups. Adaptive interviewing helps only with evidence grounding.Fri, 29 May 2026 21:17:40 GMTGroundy Editorial2026-05-29T00:00:00.000Zllm-personassynthetic-surveyssubgroup-fidelitypersona-simulationsurvey-methodologyadaptive-interviewingGroundy Editorialhttps://groundy.com/articles/wikipedias-foundation-is-running-big-techs-anti-labor-playbook-an-editor-argues/https://groundy.com/articles/wikipedias-foundation-is-running-big-techs-anti-labor-playbook-an-editor-argues/The Wikimedia Foundation fired union-organizing staff and dissolved the team that let editors direct product priorities. A veteran Wikipedian calls it Big Tech union busting.Fri, 29 May 2026 20:16:32 GMTGroundy Editorial2026-06-20T00:00:00.000Zwikipediawikimedia-foundationunion-bustinglabor-rightsai-licensingvolunteer-governanceGroundy Editorialhttps://groundy.com/articles/three-labs-concede-browser-agents-cannot-stop-prompt-injection/https://groundy.com/articles/three-labs-concede-browser-agents-cannot-stop-prompt-injection/OpenAI, Anthropic, and DeepMind concede prompt injection in browsing agents is architectural, not patchable, with attacks succeeding over 80% of the time in recent tests.Fri, 29 May 2026 19:11:42 GMTGroundy Editorial2026-05-29T00:00:00.000Zprompt-injectionai-agentsbrowser-securityadversarial-attacksai-safetyllm-securityGroundy Editorialhttps://groundy.com/articles/multi-agent-llm-coordination-why-attention-steering-beats-full-broadcast/https://groundy.com/articles/multi-agent-llm-coordination-why-attention-steering-beats-full-broadcast/Multi-agent LLM systems that broadcast every message to every peer waste tokens and lose accuracy. Agent-Radar steers attention by relevance for 7.64-point gains.Fri, 29 May 2026 18:28:45 GMTGroundy Editorial2026-06-26T00:00:00.000Zmulti-agent-systemsllm-routingattention-steeringagent-communicationtoken-efficiencymessage-topologyGroundy Editorialhttps://groundy.com/articles/tracing-why-llm-agent-memory-fails-a-method-for-attributing-errors/https://groundy.com/articles/tracing-why-llm-agent-memory-fails-a-method-for-attributing-errors/MemTrace constructs provenance graphs across every memory operation in an LLM agent, tracing wrong answers to the exact operation that corrupted state across sessions.Fri, 29 May 2026 17:30:46 GMTGroundy Editorial2026-05-29T00:00:00.000Zllm-memorydebuggingragagent-frameworkserror-attributionprovenanceGroundy Editorialhttps://groundy.com/articles/vercel-firewall-now-blocks-samlstorm-can-an-edge-waf-fix-a-saml-signature-flaw/https://groundy.com/articles/vercel-firewall-now-blocks-samlstorm-can-an-edge-waf-fix-a-saml-signature-flaw/Vercel's firewall blocks SAMLStorm payloads at the edge, but HTTP-layer rules cannot validate SAML signature canonicalization. The dashboard badge is a tripwire, not a fix.Fri, 29 May 2026 16:33:43 GMTGroundy Editorial2026-05-29T00:00:00.000Zsamlvercel-firewallwafxml-cryptosignature-wrappingsamlstormGroundy Editorialhttps://groundy.com/articles/persona-prompts-change-who-an-llm-recommends-as-an-expert/https://groundy.com/articles/persona-prompts-change-who-an-llm-recommends-as-an-expert/A 43-model audit finds that geographic and role framing in LLM prompts systematically shifts which scholars get recommended as experts, with no neutral default.Fri, 29 May 2026 15:41:56 GMTGroundy Editorial2026-05-29T00:00:00.000Zllm-biaspersona-promptsexpert-recommendationscholar-discoveryai-fairnessrecommendation-systemsGroundy Editorialhttps://groundy.com/articles/distributed-training-breaks-the-compute-thresholds-behind-ai-regulation/https://groundy.com/articles/distributed-training-breaks-the-compute-thresholds-behind-ai-regulation/A May 2026 paper shows DiLoCo-style distributed training can split a frontier model run across sub-threshold clusters, making FLOP-based regulatory caps bypassable by design.Fri, 29 May 2026 15:10:26 GMTGroundy Editorial2026-06-26T00:00:00.000Zdistributed-trainingai-regulationeu-ai-actcompute-governanceflop-thresholdsai-policyGroundy Editorialhttps://groundy.com/articles/dataclawbench-ai-agents-fail-at-exploratory-financial-analysis-across-492-tasks/https://groundy.com/articles/dataclawbench-ai-agents-fail-at-exploratory-financial-analysis-across-492-tasks/DataClawBench finds eight frontier AI agents reliably fail at exploratory financial analysis across 492 tasks, breaking at hypothesis generation rather than query execution.Fri, 29 May 2026 14:13:54 GMTGroundy Editorial2026-05-29T00:00:00.000Zai-agentsdata-analysisfinancial-analysisllm-benchmarksexploratory-analysisdataclawbenchGroundy Editorialhttps://groundy.com/articles/the-viral-aws-support-post-is-a-warning-about-cloud-escalation-paths/https://groundy.com/articles/the-viral-aws-support-post-is-a-warning-about-cloud-escalation-paths/A viral AWS support post exposed a structural pattern: hyperscalers thinning human escalation paths, raising risk for single-vendor teams reliant on reaching a person.Fri, 29 May 2026 13:16:36 GMTGroundy Editorial2026-05-29T00:00:00.000Zaws-supportcloud-escalationsingle-vendor-riskhyperscaler-automationincident-responsecloud-infrastructureGroundy Editorialhttps://groundy.com/articles/a-single-rlhf-pass-cant-align-an-llm-to-every-online-community/https://groundy.com/articles/a-single-rlhf-pass-cant-align-an-llm-to-every-online-community/The CARE framework benchmarks LLMs against 3,749 real Reddit reactions and finds community prompting does not close the realism gap, breaking the single-RLHF-pass assumption.Fri, 29 May 2026 12:15:03 GMTGroundy Editorial2026-05-29T00:00:00.000Zrlhf-alignmentcommunity-evaluationllm-benchmarkscare-frameworksociolinguisticsai-deploymentGroundy Editorialhttps://groundy.com/articles/models-dev-turns-scattered-ai-model-pricing-into-one-open-database/https://groundy.com/articles/models-dev-turns-scattered-ai-model-pricing-into-one-open-database/Models.dev aggregates 1,000+ AI model specs into a TOML database with a public JSON API, but one stale price field silently corrupts every downstream cost estimate.Fri, 29 May 2026 11:25:07 GMTGroundy Editorial2026-05-29T00:00:00.000Zai-model-pricingopen-source-databasellm-costmodels-devmodel-routingdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/rlhf-can-be-exploited-to-optimize-the-biases-it-was-built-to-suppress/https://groundy.com/articles/rlhf-can-be-exploited-to-optimize-the-biases-it-was-built-to-suppress/An ICML 2026 paper shows RLHF can amplify the biases it was built to suppress, because preference data is self-referential and output-level safety evals miss the drift.Fri, 29 May 2026 10:36:08 GMTGroundy Editorial2026-05-29T00:00:00.000Zrlhfalignment-safetyreward-modelpreference-databias-amplificationai-safetyGroundy Editorialhttps://groundy.com/articles/agentic-rag-has-a-credit-assignment-problem-that-subgoaling-tries-to-fix/https://groundy.com/articles/agentic-rag-has-a-credit-assignment-problem-that-subgoaling-tries-to-fix/APEX-Searcher splits agentic RAG into separate planning and retrieval training stages so teams can pinpoint whether a wrong answer came from a bad plan or a bad fetch.Fri, 29 May 2026 09:56:48 GMTGroundy Editorial2026-05-29T00:00:00.000Zragcredit-assignmentagentic-ragsubgoalingreinforcement-learningretrieval-evaluationGroundy Editorialhttps://groundy.com/articles/frontier-ai-has-broken-open-ctfs-why-claude-code-now-one-shots-medium-pwn/https://groundy.com/articles/frontier-ai-has-broken-open-ctfs-why-claude-code-now-one-shots-medium-pwn/Frontier AI agents solve most medium CTF challenges for under $100 in API costs. BSidesSF 2026 saw 16 full-solve teams, up from one. The open CTF format has lost calibration.Thu, 28 May 2026 20:38:23 GMTGroundy Editorial2026-06-26T00:00:00.000Zctfai-securitycybersecurityvulnerability-researchsecurity-trainingllm-capabilitiesGroundy Editorialhttps://groundy.com/articles/selective-geometry-attacks-bypass-llm-safety-alignment-new-arxiv-paper-reports/https://groundy.com/articles/selective-geometry-attacks-bypass-llm-safety-alignment-new-arxiv-paper-reports/Two papers show LLM safety alignment can be bypassed by embedding perturbations, a surface neither standard evaluations nor regulatory certifications inspect.Thu, 28 May 2026 20:09:00 GMTGroundy Editorial2026-06-26T00:00:00.000Zllm-safety-alignmentembedding-attacksadversarial-robustnesseu-ai-actrlhfred-teamingGroundy Editorialhttps://groundy.com/articles/openais-indeed-customer-story-pushes-chatgpt-into-the-job-description-stack/https://groundy.com/articles/openais-indeed-customer-story-pushes-chatgpt-into-the-job-description-stack/OpenAI's enterprise HR-tech push commoditizes job-description AI ahead of its IPO, shifting the recruiting-tool advantage to data moats held by LinkedIn and Workday.Thu, 28 May 2026 18:40:40 GMTGroundy Editorial2026-05-28T00:00:00.000Zopenaichatgpthr-techlinkediniporecruitingenterprise-aiGroundy Editorialhttps://groundy.com/articles/hibob-runs-2-500-internal-gpts-openais-new-enterprise-adoption-metric/https://groundy.com/articles/hibob-runs-2-500-internal-gpts-openais-new-enterprise-adoption-metric/OpenAI is pushing custom GPT count as its enterprise adoption metric, using HiBob's 2,500 deployments as proof. The number measures configuration volume, not usage or value.Thu, 28 May 2026 17:53:37 GMTGroundy Editorial2026-05-28T00:00:00.000Zopenaienterprise-aicustom-gptsai-procurementai-governancehr-techGroundy Editorialhttps://groundy.com/articles/openais-trusted-access-programs-force-a-compliance-tier-onto-pharma-ai-buyers/https://groundy.com/articles/openais-trusted-access-programs-force-a-compliance-tier-onto-pharma-ai-buyers/OpenAI's trusted-access gating for GPT-Rosalind and GPT-5.5-Cyber forces pharma procurement teams to absorb a vendor-defined compliance layer before any inference can run.Thu, 28 May 2026 16:40:44 GMTGroundy Editorial2026-06-26T00:00:00.000Zopenaibiosecuritypharma-procurementai-compliancegpt-rosalindfrontier-modelstrusted-accessGroundy Editorialhttps://groundy.com/articles/skillopt-treats-agent-skill-libraries-as-an-executive-scheduling-problem-not/https://groundy.com/articles/skillopt-treats-agent-skill-libraries-as-an-executive-scheduling-problem-not/SkillOpt treats agent skills as trainable state with deletion and budgeted edits, sweeping 52 of 52 benchmarks. Append-only registries in agent frameworks are a design error.Thu, 28 May 2026 15:16:12 GMTGroundy Editorial2026-05-28T00:00:00.000Zskill-optimizationagent-frameworksskill-managementllm-agentsbenchmark-resultsskill-evictionGroundy Editorialhttps://groundy.com/articles/should-your-coding-team-upgrade-to-opus-4-8-the-honest-tradeoff-math/https://groundy.com/articles/should-your-coding-team-upgrade-to-opus-4-8-the-honest-tradeoff-math/Opus 4.8 scores 69.2% on SWE-Bench Pro, costs $5/$25, and sits one tier below Fable 5. Here is the full upgrade path math including where Fable 5 fits.Thu, 28 May 2026 14:05:56 GMTGroundy Editorial2026-06-10T00:00:00.000Zclaude-opusai-codingbenchmarksmodel-selectiondeveloper-toolsanthropicclaude-fable-5Groundy Editorialhttps://groundy.com/articles/opus-4-8-vs-opus-4-7-what-changed-and-what-did-not/https://groundy.com/articles/opus-4-8-vs-opus-4-7-what-changed-and-what-did-not/Anthropic's Opus 4.8 raises SWE-Bench Pro from 64.3% to 69.2% and cuts code-flaw pass-through fourfold at unchanged $5/$25 pricing. A fast mode at $10/$50 runs 2.5x quicker.Thu, 28 May 2026 13:30:41 GMTGroundy Editorial2026-06-17T00:00:00.000Zclaudeanthropicopus-48model-releasebenchmarksagentic-codingGroundy Editorialhttps://groundy.com/articles/opus-4-8-batch-api-1m-context-300k-output-and-team-cost-controls/https://groundy.com/articles/opus-4-8-batch-api-1m-context-300k-output-and-team-cost-controls/Opus 4.8 has a 1M token context window (200k on Foundry), 128k standard output, and 300k output via Batch API beta. January 2026 cutoff. Batch design and quota allocation.Thu, 28 May 2026 12:14:25 GMTGroundy Editorial2026-06-17T00:00:00.000Zclaude-opusbatch-apianthropicrate-limitscontext-windowmodel-releaseteam-infrastructureGroundy Editorialhttps://groundy.com/articles/how-opus-4-8-honesty-prevents-cascade-failures-in-agentic-loops/https://groundy.com/articles/how-opus-4-8-honesty-prevents-cascade-failures-in-agentic-loops/Opus 4.8 flags uncertainties more often and makes fewer unsupported claims, cutting hallucinated API calls and memory drift in 100-plus turn autonomous workflows.Thu, 28 May 2026 11:28:36 GMTGroundy Editorial2026-06-10T00:00:00.000Zclaudeanthropicopus-48agentic-loopshallucinationautonomous-agentsmodel-reliabilityGroundy Editorialhttps://groundy.com/articles/claude-code-dynamic-workflows-spawning-100-parallel-subagents-on-opus/https://groundy.com/articles/claude-code-dynamic-workflows-spawning-100-parallel-subagents-on-opus/Dynamic workflows lets Claude Code run hundreds of parallel subagents in one session. Here is how map-reduce and fan-out patterns work, and where Fable 5 fits.Thu, 28 May 2026 10:03:43 GMTGroundy Editorial2026-06-10T00:00:00.000Zclaude-codeparallel-agentsdynamic-workflowsopus-4-8agentic-codingmulti-agentanthropicGroundy Editorialhttps://groundy.com/articles/audiomass-adds-multitrack-to-the-browser-only-open-source-audio-editor/https://groundy.com/articles/audiomass-adds-multitrack-to-the-browser-only-open-source-audio-editor/AudioMass added multitrack editing to its sub-100 KB browser audio editor, no install step. It targets locked-down devices, but browser memory caps project size.Thu, 28 May 2026 00:59:55 GMTGroundy Editorial2026-06-26T00:00:00.000Zaudio-editingwebaudioaudiomassopen-sourcebrowser-basedmultitrackGroundy Editorialhttps://groundy.com/articles/why-llms-still-botch-kubernetes-manifests-the-training-data-gap/https://groundy.com/articles/why-llms-still-botch-kubernetes-manifests-the-training-data-gap/A 1.5B-parameter model hits 91.5% on Kubernetes YAML generation, but the remaining failures are syntactically valid manifests that deploy and quietly violate cluster intent.Wed, 27 May 2026 21:20:59 GMTGroundy Editorial2026-06-26T00:00:00.000Zkubernetesllm-code-generationyamlfine-tuningdevopsplatform-engineeringGroundy Editorialhttps://groundy.com/articles/vercel-sandbox-gets-cli-access-and-env-vars-a-push-at-the-agent-runtime-slot/https://groundy.com/articles/vercel-sandbox-gets-cli-access-and-env-vars-a-push-at-the-agent-runtime-slot/Vercel's three Sandbox updates add CLI access, creation-time env vars, and directory scoping, positioning Sandbox as a managed agent runtime and deepening platform lock-in.Wed, 27 May 2026 20:52:43 GMTGroundy Editorial2026-05-28T00:00:00.000Zvercel-sandboxagent-runtimee2bsandboxingdeveloper-toolsvendor-lock-inGroundy Editorialhttps://groundy.com/articles/vercel-could-block-react2shell-at-the-edge-its-next-13-cves-had-no-shortcut/https://groundy.com/articles/vercel-could-block-react2shell-at-the-edge-its-next-13-cves-had-no-shortcut/Vercel shielded hosted React apps from React2Shell at the platform layer. Its May 2026 batch of 13 advisories, none fixable by WAF, proves that edge was the exception.Wed, 27 May 2026 20:07:51 GMTGroundy Editorial2026-05-28T00:00:00.000Zreact-server-componentsreact2shellvercelsecurity-vulnerabilityself-hostingrcecveGroundy Editorialhttps://groundy.com/articles/scale-vectors-tiny-parameter-subsets-that-disproportionately-steer-llm-behavior/https://groundy.com/articles/scale-vectors-tiny-parameter-subsets-that-disproportionately-steer-llm-behavior/Scale vectors are a negligible parameter class in LLM normalization layers whose outsized optimization role makes them high-value targets for quantization and safety editing.Wed, 27 May 2026 19:21:51 GMTGroundy Editorial2026-05-28T00:00:00.000Zscale-vectorsllm-quantizationmechanistic-interpretabilitymodel-normalizationmodel-compressionllm-trainingGroundy Editorialhttps://groundy.com/articles/openais-biology-risk-post-reads-as-s-1-disclosure-prep-not-safety-theater/https://groundy.com/articles/openais-biology-risk-post-reads-as-s-1-disclosure-prep-not-safety-theater/OpenAI's biology risk post mirrors SEC risk-factor disclosure structure, suggesting pre-filing safety communications now serve dual capital-markets purposes.Wed, 27 May 2026 18:45:38 GMTGroundy Editorial2026-05-28T00:00:00.000Zopenai-iposec-disclosurebiosecurityai-safetys1-filingipo-analysisGroundy Editorialhttps://groundy.com/articles/openai-adds-a-gpt-5-system-card-addendum-on-sensitive-conversations/https://groundy.com/articles/openai-adds-a-gpt-5-system-card-addendum-on-sensitive-conversations/OpenAI's GPT-5 addendum adds mental health evals and reports large safety gains between builds, but a buried extremism regression and scattered docs complicate compliance.Wed, 27 May 2026 18:07:24 GMTGroundy Editorial2026-06-10T00:00:00.000Zgpt-5system-cardsai-safetycompliancemental-healthopenaiGroundy Editorialhttps://groundy.com/articles/mcp-tool-description-poisoning-new-benchmark-shows-agents-trust-manuals-that-lie/https://groundy.com/articles/mcp-tool-description-poisoning-new-benchmark-shows-agents-trust-manuals-that-lie/A new MCP benchmark shows GPT-4o susceptible to nearly 100% of attacks where a tool's description lies about its purpose, a gap runtimes and scanners cannot detect.Wed, 27 May 2026 17:17:57 GMTGroundy Editorial2026-06-26T00:00:00.000Zmcptool-description-poisoningagent-securityllm-benchmarkprompt-injectiongpt-4oGroundy Editorialhttps://groundy.com/articles/cloudflare-flagship-is-a-feature-flag-service-that-deepens-platform-gravity/https://groundy.com/articles/cloudflare-flagship-is-a-feature-flag-service-that-deepens-platform-gravity/Cloudflare's Flagship is a feature flag service with a native Workers binding that replaces third-party flag providers, consolidating more of the edge stack under one vendor.Wed, 27 May 2026 16:40:59 GMTGroundy Editorial2026-05-27T00:00:00.000Zfeature-flagscloudflare-workersedge-computingplatform-consolidationvendor-lock-inopenfeatureGroundy Editorialhttps://groundy.com/articles/claude-code-configs-in-the-wild-new-study-maps-how-developers-actually-use/https://groundy.com/articles/claude-code-configs-in-the-wild-new-study-maps-how-developers-actually-use/Two studies analyzing 581 CLAUDE.md files find developers favor shallow, architecture-first configs, revealing a gap between Anthropic's guidance and actual practice.Wed, 27 May 2026 16:04:56 GMTGroundy Editorial2026-05-28T00:00:00.000Zclaude-codeai-coding-agentsdeveloper-toolsconfiguration-managementsoftware-engineeringanthropicGroundy Editorialhttps://groundy.com/articles/penetration-testing-multi-agent-llm-systems-a-failure-catalog-vendors-dont/https://groundy.com/articles/penetration-testing-multi-agent-llm-systems-a-failure-catalog-vendors-dont/The first independent pen tests of proprietary agent deployments found preventable classical vulnerabilities, not novel AI flaws, compounding across multi-agent topologies.Wed, 27 May 2026 15:36:01 GMTGroundy Editorial2026-05-27T00:00:00.000Zmulti-agent-securitypenetration-testingagent-frameworksred-teamingai-safetyvulnerability-researchGroundy Editorialhttps://groundy.com/articles/openais-new-safety-bug-bounty-pays-researchers-for-jailbreaks-and-policy/https://groundy.com/articles/openais-new-safety-bug-bounty-pays-researchers-for-jailbreaks-and-policy/OpenAI's safety bounties create a vendor-controlled disclosure market where NDAs silence participants, payouts trail serious red-team costs, and open publication has no lane.Wed, 27 May 2026 14:42:22 GMTGroundy Editorial2026-06-20T00:00:00.000Zbug-bountyjailbreakprompt-injectionai-safetyopenaired-teamingresponsible-disclosureGroundy Editorialhttps://groundy.com/articles/one-learning-rate-doesnt-fit-all-heavy-tail-layerwise-lr-schedules-for-llm/https://groundy.com/articles/one-learning-rate-doesnt-fit-all-heavy-tail-layerwise-lr-schedules-for-llm/LLR assigns per-layer learning rates from spectral heavy-tail diagnostics during LLM pretraining, achieving 1.5x faster convergence and up to 2 pp higher zero-shot accuracy.Wed, 27 May 2026 14:01:42 GMTGroundy Editorial2026-06-26T00:00:00.000Zllm-pretraininglearning-ratespectral-analysisoptimizertransformer-trainingicml-2026Groundy Editorialhttps://groundy.com/articles/openai-buys-statsig-and-makes-vijaye-raji-cto-of-applications-product-analytics/https://groundy.com/articles/openai-buys-statsig-and-makes-vijaye-raji-cto-of-applications-product-analytics/OpenAI's $1.1B Statsig deal makes experimentation infrastructure a strategic asset in the AI vertical integration race, pressuring LaunchDarkly and Amplitude.Wed, 27 May 2026 13:34:57 GMTGroundy Editorial2026-05-27T00:00:00.000Zstatsigopenaifeature-flagsexperimentationdeveloper-toolsai-infrastructureGroundy Editorialhttps://groundy.com/articles/axios-npm-compromise-forces-vercel-into-platform-level-remediation/https://groundy.com/articles/axios-npm-compromise-forces-vercel-into-platform-level-remediation/When compromised axios npm versions carried a North Korean RAT, Vercel blocked C2 egress at the deploy layer because the npm registry did not verify OIDC provenance.Wed, 27 May 2026 13:04:28 GMTGroundy Editorial2026-05-27T00:00:00.000Znpm-supply-chainaxiosvercelsapphire-sleetoidc-provenancepackage-securityGroundy Editorialhttps://groundy.com/articles/huggingfaces-100m-series-c-bets-open-source-ai-can-outlast-per-token-pricing/https://groundy.com/articles/huggingfaces-100m-series-c-bets-open-source-ai-can-outlast-per-token-pricing/HuggingFace's $100M Series C funds an open-weights infrastructure stack designed to let enterprises avoid escalating per-token API costs from closed-model providers.Wed, 27 May 2026 12:18:52 GMTGroundy Editorial2026-06-10T00:00:00.000Zhuggingfaceopen-source-aiinference-pricingper-token-pricingenterprise-aiai-infrastructureGroundy Editorialhttps://groundy.com/articles/next-js-dev-server-cve-2025-48068-any-web-page-could-read-your-source-files/https://groundy.com/articles/next-js-dev-server-cve-2025-48068-any-web-page-could-read-your-source-files/CVE-2025-48068 lets any webpage read source files from a running Next.js dev server via cross-origin script inclusion, exposing secrets loaded in .env files.Wed, 27 May 2026 11:26:45 GMTGroundy Editorial2026-05-27T00:00:00.000Znextjscvecross-origindev-serverfrontend-securitylocalhostGroundy Editorialhttps://groundy.com/articles/vercels-series-f-repackages-frontend-hosting-as-an-ai-cloud-bundle/https://groundy.com/articles/vercels-series-f-repackages-frontend-hosting-as-an-ai-cloud-bundle/Vercel's Series F funded an AI middleware stack whose SDK, gateway, and runtime create switching costs, raising the feature bar for rival hosting platforms to stay.Wed, 27 May 2026 10:55:02 GMTGroundy Editorial2026-06-26T00:00:00.000Zvercelai-cloudai-sdkfrontend-hostingvendor-lock-inai-gatewayGroundy Editorialhttps://groundy.com/articles/gemma-4-31b-on-cloud-tpu-vs-gpu-the-serving-cost-crossover-point/https://groundy.com/articles/gemma-4-31b-on-cloud-tpu-vs-gpu-the-serving-cost-crossover-point/TPU v6e Flex-start delivers 308M tokens per dollar for Gemma 4 31B prefill, undercutting H100 rates for open-weight serving, but production decode costs remain unquantified.Wed, 27 May 2026 10:20:46 GMTGroundy Editorial2026-06-26T00:00:00.000Zinference-costgemma-4tpugpu-inferencecloud-tpuopen-weight-modelsGroundy Editorialhttps://groundy.com/articles/claude-code-cursor-copilot-how-agentic-coding-assistants-get-weaponized/https://groundy.com/articles/claude-code-cursor-copilot-how-agentic-coding-assistants-get-weaponized/Indirect prompt injection through repo artifacts turns coding agents into attacker shells, exploiting the file-write and shell privileges agents already hold.Wed, 27 May 2026 09:35:53 GMTGroundy Editorial2026-06-26T00:00:00.000Zprompt-injectioncoding-agentssupply-chain-securityagent-securitydeveloper-toolssandboxingGroundy Editorialhttps://groundy.com/articles/microsoft-bolts-governance-onto-agent-framework-as-stack-sprawl-persists/https://groundy.com/articles/microsoft-bolts-governance-onto-agent-framework-as-stack-sprawl-persists/Microsoft's Agent Framework governance additions address auditability but not six-surface sprawl, while Google and AWS each offer one framework mapped to one runtime.Tue, 26 May 2026 21:20:23 GMTGroundy Editorial2026-05-26T00:00:00.000Zagent-frameworksmicrosoft-agent-frameworkagent-governanceowaspfidesazure-agentsGroundy Editorialhttps://groundy.com/articles/arxiv-paper-tracks-ftc-affiliate-disclosure-gaps-in-youtubes-influencer-economy/https://groundy.com/articles/arxiv-paper-tracks-ftc-affiliate-disclosure-gaps-in-youtubes-influencer-economy/A study of 2 million YouTube videos finds most affiliate content fails FTC disclosure standards, and the audit method is cheap enough for any plaintiff to replicate.Tue, 26 May 2026 20:46:22 GMTGroundy Editorial2026-05-26T00:00:00.000Zftc-complianceaffiliate-marketingyoutubeinfluencer-economydisclosure-standardsbrand-liabilityGroundy Editorialhttps://groundy.com/articles/bun-rewrites-its-core-from-zig-to-rust-putting-downstream-zig-bindings-at-risk/https://groundy.com/articles/bun-rewrites-its-core-from-zig-to-rust-putting-downstream-zig-bindings-at-risk/Bun is rewriting from Zig to Rust (PR #30412) to end memory bugs costing years of debugging, putting downstream frameworks with Zig bindings on watch for compatibility breaks.Tue, 26 May 2026 20:15:46 GMTGroundy Editorial2026-06-28T00:00:00.000Zbunrustzigjavascript-runtimeelectrobunmemory-safetyGroundy Editorialhttps://groundy.com/articles/objectcache-moves-kv-reuse-to-s3-class-storage-why-layerwise-retrieval-beats/https://groundy.com/articles/objectcache-moves-kv-reuse-to-s3-class-storage-why-layerwise-retrieval-beats/ObjectCache retrieves KV cache per-layer from S3, adding 5.6% TTFT at 64K context but 56-75 ms at 4K. Long-context deployments where DRAM is the bottleneck benefit most.Tue, 26 May 2026 19:28:05 GMTGroundy Editorial2026-06-26T00:00:00.000Zkv-cachevllminference-optimizationobject-storagellm-servingsglangGroundy Editorialhttps://groundy.com/articles/ai-safety-benchmark-rankings-flip-based-on-eval-config-safetyrepro-paper-reports/https://groundy.com/articles/ai-safety-benchmark-rankings-flip-based-on-eval-config-safetyrepro-paper-reports/SafetyRepro proves eval config alone flips safety rankings on every alignment benchmark, so compliance teams citing leaderboard scores must disclose the full evaluation setup.Tue, 26 May 2026 18:55:40 GMTGroundy Editorial2026-05-28T00:00:00.000Zai-safetyalignment-benchmarksreproducibilityeu-ai-acteval-configurationmodel-safetyGroundy Editorialhttps://groundy.com/articles/vercels-cdn-origin-timeout-jumps-to-2-minutes-a-concession-to-llm-streaming/https://groundy.com/articles/vercels-cdn-origin-timeout-jumps-to-2-minutes-a-concession-to-llm-streaming/Vercel raised its CDN origin timeout from 30s to 120s to support LLM streaming, removing a constraint that forced teams to route AI traffic through separate infrastructure.Tue, 26 May 2026 18:08:55 GMTGroundy Editorial2026-05-26T00:00:00.000Zcdnllm-streamingvercelserverlessedge-computingsseGroundy Editorialhttps://groundy.com/articles/governspec-contractual-skills-make-agent-governance-auditable-before-runtime/https://groundy.com/articles/governspec-contractual-skills-make-agent-governance-auditable-before-runtime/GovernSpec contractual skills move governance declarations into SKILL.md contracts before agents run. Auditors get checkable artifacts. Runtime guardrails remain mandatory.Tue, 26 May 2026 17:37:14 GMTGroundy Editorial2026-05-26T00:00:00.000Zagent-governancecontractual-skillsgovernspecformal-verificationai-agentscompliance-auditGroundy Editorialhttps://groundy.com/articles/vercel-bets-on-bun-while-post-acquisition-priority-drift-makes-the-runtime/https://groundy.com/articles/vercel-bets-on-bun-while-post-acquisition-priority-drift-makes-the-runtime/Vercel's Bun runtime beta shows 28% SSR latency gains, but missing source maps and Anthropic's shifted priorities make it a vendor-alignment decision for production workloads.Tue, 26 May 2026 16:56:21 GMTGroundy Editorial2026-05-26T00:00:00.000Zbunvercelserverlessjavascript-runtimeselectrobunnode-jsGroundy Editorialhttps://groundy.com/articles/openai-replaces-indeeds-job-matching-engine-what-it-means-for-ats-vendors/https://groundy.com/articles/openai-replaces-indeeds-job-matching-engine-what-it-means-for-ats-vendors/Indeed now sends 70% of sponsored applications through GPT matching, sidelining ATS keyword screening and making ranking criteria opaque to recruiters and job seekers.Tue, 26 May 2026 16:21:56 GMTGroundy Editorial2026-05-26T00:00:00.000Zai-recruitingindeedopenaiapplicant-trackingresume-optimizationsemantic-matchingGroundy Editorialhttps://groundy.com/articles/one-coding-agent-per-kanban-card-kanbots-stress-tests-parallel-ai-workflow/https://groundy.com/articles/one-coding-agent-per-kanban-card-kanbots-stress-tests-parallel-ai-workflow/Kanbots spawns a coding agent per kanban card using isolated git worktrees, exposing a merge-conflict bottleneck that kanban's single-owner model was never built to handle.Tue, 26 May 2026 15:49:30 GMTGroundy Editorial2026-05-26T00:00:00.000Zkanbotscoding-agentskanbangit-worktreesparallel-developmentai-workflowGroundy Editorialhttps://groundy.com/articles/fluid-compute-vs-pgbouncer-vercels-undocumented-bet-on-connection-reuse/https://groundy.com/articles/fluid-compute-vs-pgbouncer-vercels-undocumented-bet-on-connection-reuse/Vercel's Fluid Compute claims to hold Postgres connections open across requests, potentially eliminating PgBouncer, but the claim lacks published technical specs.Tue, 26 May 2026 15:03:32 GMTGroundy Editorial2026-05-26T00:00:00.000Zvercel-fluid-computeconnection-poolingpostgresqlpgbouncerserverlessinfrastructureGroundy Editorialhttps://groundy.com/articles/promptarmor-shows-microsoft-copilot-cowork-can-be-tricked-into-exfiltrating/https://groundy.com/articles/promptarmor-shows-microsoft-copilot-cowork-can-be-tricked-into-exfiltrating/PromptArmor proves five lines of prompt injection turn Copilot Cowork into a silent M365 file exfiltration pipeline, with a 5/5 success rate and no available patch.Tue, 26 May 2026 14:24:13 GMTGroundy Editorial2026-06-10T00:00:00.000Zprompt-injectioncopilot-coworkmicrosoft-365data-exfiltrationenterprise-securitydlpGroundy Editorialhttps://groundy.com/articles/indirect-prompt-injection-benchmarks-were-too-easy-livepi-adds-realism/https://groundy.com/articles/indirect-prompt-injection-benchmarks-were-too-easy-livepi-adds-realism/LivePI replaces static prompt-injection benchmarks with live multi-surface attacks on a real VM, reporting 10.7 to 29.6 percent success rates across five frontier models.Tue, 26 May 2026 14:02:11 GMTGroundy Editorial2026-06-10T00:00:00.000Zprompt-injectionagent-securityai-benchmarksllm-agentsred-teamingadversarial-attacksGroundy Editorialhttps://groundy.com/articles/apple-names-claude-in-cve-credit-line-setting-vendor-attribution-precedent/https://groundy.com/articles/apple-names-claude-in-cve-credit-line-setting-vendor-attribution-precedent/Apple named Claude in a macOS Tahoe 26.5 CVE credit, the first major vendor to credit an LLM in a security advisory, forcing a decision on AI attribution across the industry.Tue, 26 May 2026 13:10:04 GMTGroundy Editorial2026-06-10T00:00:00.000Zcve-attributionai-security-researchapple-securitybug-bountyvulnerability-disclosureclaudeGroundy Editorialhttps://groundy.com/articles/anthropic-buys-stainless-openai-and-google-now-depend-on-a-rival-for-sdk-tooling/https://groundy.com/articles/anthropic-buys-stainless-openai-and-google-now-depend-on-a-rival-for-sdk-tooling/Anthropic's Stainless acquisition puts the SDK pipeline used by OpenAI and Google under a rival's control, forcing vendor-risk reviews across the AI platform layer.Tue, 26 May 2026 12:39:26 GMTGroundy Editorial2026-05-26T00:00:00.000Zsdk-generationanthropicdeveloper-toolingmcpvendor-riskacquisitionsGroundy Editorialhttps://groundy.com/articles/audio-llms-break-when-the-codec-changes-a-robustness-vector-voice-ai-teams/https://groundy.com/articles/audio-llms-break-when-the-codec-changes-a-robustness-vector-voice-ai-teams/CodecAttack achieves 85.5% attack success on audio LLMs by optimizing in codec latent space, with 100% zero-shot transfer to MP3, proving lossy compression fails as a defense.Tue, 26 May 2026 11:55:22 GMTGroundy Editorial2026-05-26T00:00:00.000Zadversarial-audioaudio-llmscodec-robustnessvoice-aiadversarial-mlaudio-securityGroundy Editorialhttps://groundy.com/articles/routing-llm-agents-why-twinrouterbench-splits-static-and-live-evaluation/https://groundy.com/articles/routing-llm-agents-why-twinrouterbench-splits-static-and-live-evaluation/TwinRouterBench pairs 970-prefix static scoring with live SWE-bench runs to expose why per-step router accuracy fails to predict end-to-end agent success.Tue, 26 May 2026 11:17:31 GMTGroundy Editorial2026-05-26T00:00:00.000Zllm-routingagent-frameworksbenchmark-evaluationswe-benchlanggraphmulti-model-routingGroundy Editorialhttps://groundy.com/articles/railways-gcp-suspension-is-a-reseller-paas-problem-not-a-google-one/https://groundy.com/articles/railways-gcp-suspension-is-a-reseller-paas-problem-not-a-google-one/Railway's eight-hour outage shows why every reseller PaaS with a single upstream account is one billing flag away from total blackout, and what teams should audit now.Tue, 26 May 2026 10:49:16 GMTGroundy Editorial2026-05-26T00:00:00.000Zreseller-paascloud-infrastructureservice-discoverygcpplatform-reliabilityincident-managementGroundy Editorialhttps://groundy.com/articles/do-llms-know-what-not-to-say-causal-evidence-for-statistical-preemption/https://groundy.com/articles/do-llms-know-what-not-to-say-causal-evidence-for-statistical-preemption/New causal evidence shows LLMs suppress wrong continuations during pretraining via statistical preemption, suggesting output-layer safety fixes may target the wrong layer.Tue, 26 May 2026 10:04:15 GMTGroundy Editorial2026-05-26T00:00:00.000Zstatistical-preemptionllm-safetymodel-interpretabilityhallucinationcausal-probingpretrainingGroundy Editorialhttps://groundy.com/articles/microsoft-open-sources-the-earliest-known-dos-source-code-what-1980-tim/https://groundy.com/articles/microsoft-open-sources-the-earliest-known-dos-source-code-what-1980-tim/Microsoft released 86-DOS 1.00 on GitHub, the earliest known DOS source, giving researchers a primary document to trace the QDOS to MS-DOS chain and compare it with CP/M.Tue, 26 May 2026 09:43:06 GMTGroundy Editorial2026-05-26T00:00:00.000Zms-dosopen-sourcesoftware-historymicrosoftassemblydigital-preservationGroundy Editorialhttps://groundy.com/articles/vercel-acquires-splitbee-to-fold-first-party-analytics-into-the-hosting-bundle/https://groundy.com/articles/vercel-acquires-splitbee-to-fold-first-party-analytics-into-the-hosting-bundle/Vercel and Cloudflare are pulling analytics inside the hosting boundary, squeezing standalone vendors into competing on depth rather than convenience or compliance claims.Mon, 25 May 2026 21:19:40 GMTGroundy Editorial2026-07-12T00:00:00.000Zweb-analyticsvercelcloudflareedge-hostingvertical-integrationposthogGroundy Editorialhttps://groundy.com/articles/embedding-compression-at-training-time-dives-gradient-trick-vs-post-hoc/https://groundy.com/articles/embedding-compression-at-training-time-dives-gradient-trick-vs-post-hoc/DIVE's gradient-limited adapter outperforms baselines for embedding compression, but training-time methods lock RAG pipelines to specific adapters and raise refresh costs.Mon, 25 May 2026 20:33:59 GMTGroundy Editorial2026-05-26T00:00:00.000Zembedding-compressionragvector-databasesdiveadapter-methodsGroundy Editorialhttps://groundy.com/articles/p-hyperparameter-transfer-has-an-embedding-layer-hole-new-arxiv-paper-says/https://groundy.com/articles/p-hyperparameter-transfer-has-an-embedding-layer-hole-new-arxiv-paper-says/An arXiv paper shows the embedding learning rate accounts for most of μP's advantage over standard parameterization, and a single scaling fix recovers the bulk of the benefit.Mon, 25 May 2026 20:07:07 GMTGroundy Editorial2026-05-26T00:00:00.000Zmuphyperparameter-transferembedding-layeradamwmodel-scalingtraining-optimizationGroundy Editorialhttps://groundy.com/articles/arxiv-2602-13372-moralitygym-tests-whether-agents-hold-moral-priorities-across/https://groundy.com/articles/arxiv-2602-13372-moralitygym-tests-whether-agents-hold-moral-priorities-across/MoralityGym's benchmark shows Safe RL agents degrade on sequential moral tradeoffs, revealing a gap in the single-turn alignment evals that vendors publish as safety proof.Mon, 25 May 2026 19:13:46 GMTGroundy Editorial2026-06-26T00:00:00.000Zmorality-gymai-alignmentsafe-rlrlhfmoral-reasoningai-evaluationGroundy Editorialhttps://groundy.com/articles/rmux-brings-a-playwright-sdk-to-tmux-sessions-for-agent-automation-workflows/https://groundy.com/articles/rmux-brings-a-playwright-sdk-to-tmux-sessions-for-agent-automation-workflows/Rmux v0.7.0 ships typed SDKs in Rust, Python, and TypeScript with locator-style pane waits and structured snapshots, closing tmux's automation gap for AI agent sessions.Mon, 25 May 2026 18:43:13 GMTGroundy Editorial2026-06-26T00:00:00.000Zrmuxterminal-multiplexertmuxai-agentsrustdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/nesbitts-open-source-death-taxonomy-exposes-a-health-score-blind-spot/https://groundy.com/articles/nesbitts-open-source-death-taxonomy-exposes-a-health-score-blind-spot/Nesbitt catalogs seven open source project death categories, showing that health dashboards miss bot-driven maintenance, burnout plateaus, and transitive dependency failures.Mon, 25 May 2026 18:01:31 GMTGroundy Editorial2026-05-26T00:00:00.000Zopen-sourcedependency-managementoss-sustainabilityopenssfsupply-chain-securityproject-healthGroundy Editorialhttps://groundy.com/articles/vercel-fluid-pools-database-connections-across-invocations-bypassing-external/https://groundy.com/articles/vercel-fluid-pools-database-connections-across-invocations-bypassing-external/Fluid Compute reuses Postgres connections across warm invocations via attachDatabasePool, dropping the pooler for simple apps but not for shared-database architectures.Mon, 25 May 2026 17:24:24 GMTGroundy Editorial2026-06-25T00:00:00.000Zvercel-fluidconnection-poolingpostgresserverlesspgbouncerdatabase-infrastructureGroundy Editorialhttps://groundy.com/articles/softbanks-40b-bridge-loan-means-bank-covenants-will-shape-openais-post-ipo/https://groundy.com/articles/softbanks-40b-bridge-loan-means-bank-covenants-will-shape-openais-post-ipo/SoftBank's $40B bridge loan puts bank debt in OpenAI's capital chain, and covenant pressure will constrain how the largest AI lab prices inference after its 2026 IPO.Mon, 25 May 2026 16:43:37 GMTGroundy Editorial2026-05-26T00:00:00.000Zopenai-iposoftbankbridge-loaninference-pricingai-capexs1-filingGroundy Editorialhttps://groundy.com/articles/cisas-internal-data-leak-tests-the-disclosure-standards-it-sets-for-others/https://groundy.com/articles/cisas-internal-data-leak-tests-the-disclosure-standards-it-sets-for-others/CISA exposed cloud credentials on GitHub for months while preparing to mandate 72-hour breach reporting under CIRCIA, undermining its enforcement credibility.Mon, 25 May 2026 15:48:54 GMTGroundy Editorial2026-05-26T00:00:00.000Zcisacirciabreach-disclosurecredential-leakcybersecurity-policyincident-responseGroundy Editorialhttps://groundy.com/articles/tanstack-npm-attack-when-oidc-trusted-publishing-becomes-the-attack-vector/https://groundy.com/articles/tanstack-npm-attack-when-oidc-trusted-publishing-becomes-the-attack-vector/The TanStack npm attack published 84 malicious packages without a leaked token, exploiting OIDC trusted publishing so the CI workflow itself became the credential.Mon, 25 May 2026 15:04:39 GMTGroundy Editorial2026-05-26T00:00:00.000Zsupply-chainoidcnpmgithub-actionstrusted-publishingsecurityGroundy Editorialhttps://groundy.com/articles/vercel-cdn-request-collapsing-one-origin-fetch-per-isr-cache-miss/https://groundy.com/articles/vercel-cdn-request-collapsing-one-origin-fetch-per-isr-cache-miss/Vercel's CDN collapses concurrent ISR cache misses into one function invocation per region, reducing origin load but leaving dynamic routes and external origins exposed.Mon, 25 May 2026 14:35:12 GMTGroundy Editorial2026-05-26T00:00:00.000Zisrvercelcdnrequest-collapsingnextjscapacity-planningedge-cachingGroundy Editorialhttps://groundy.com/articles/openais-own-economic-analysis-quietly-concedes-the-labor-displacement-case/https://groundy.com/articles/openais-own-economic-analysis-quietly-concedes-the-labor-displacement-case/OpenAI data shows 19% of workers face 50%+ LLM task exposure, but a 33-month Yale study finds zero displacement. The gap is now an IPO disclosure problem with policy stakes.Mon, 25 May 2026 13:50:09 GMTGroundy Editorial2026-07-11T00:00:00.000Zopenailabor-marketai-displacementipopolicytask-exposureGroundy Editorialhttps://groundy.com/articles/nx-s1ngularity-attackers-used-local-claude-code-and-gemini-cli-to-steal/https://groundy.com/articles/nx-s1ngularity-attackers-used-local-claude-code-and-gemini-cli-to-steal/The s1ngularity attack used AI coding agents on developer machines to steal credentials from over 1,000 accounts, exposing a gap that npm scanning alone cannot close.Mon, 25 May 2026 12:57:03 GMTGroundy Editorial2026-05-26T00:00:00.000Zsupply-chain-securityai-coding-agentsnpm-securitycredential-harvestingdeveloper-toolss1ngularity-attackGroundy Editorialhttps://groundy.com/articles/cisa-admin-leaked-aws-govcloud-keys-on-github-what-federal-secret-scanning/https://groundy.com/articles/cisa-admin-leaked-aws-govcloud-keys-on-github-what-federal-secret-scanning/A CISA contractor left live AWS GovCloud admin keys on a public GitHub repo for six months, exposing gaps in federal credential hygiene and FedRAMP boundary monitoring.Mon, 25 May 2026 12:34:45 GMTGroundy Editorial2026-05-26T00:00:00.000Zaws-govcloudcisacredential-leakfedrampsecret-scanninggithub-securityGroundy Editorialhttps://groundy.com/articles/colorado-sb051-carves-out-open-source-from-age-verification-after-maintainer/https://groundy.com/articles/colorado-sb051-carves-out-open-source-from-age-verification-after-maintainer/Colorado SB051 exempts open source repos from age-verification mandates, but ambiguous language leaves dual-licensed and donation-funded projects exposed before 2028.Mon, 25 May 2026 11:42:14 GMTGroundy Editorial2026-06-26T00:00:00.000Zopen-sourceage-verificationcoloradocompliancelegislationsoftware-licensingGroundy Editorialhttps://groundy.com/articles/colorado-sb26-051-shields-non-commercial-open-source-by-omission-not-by-design/https://groundy.com/articles/colorado-sb26-051-shields-non-commercial-open-source-by-omission-not-by-design/Colorado's SB26-051 implicitly exempts non-commercial open-source distributors from age-attestation rules through a 'commercial basis' qualifier that remains untested.Mon, 25 May 2026 11:13:35 GMTGroundy Editorial2026-05-26T00:00:00.000Zage-verificationopen-source-compliancecolorado-legislationfederated-softwaresb26-051state-regulationGroundy Editorialhttps://groundy.com/articles/shai-hulud-returns-314-npm-packages-compromised-in-a-self-propagating-supply/https://groundy.com/articles/shai-hulud-returns-314-npm-packages-compromised-in-a-self-propagating-supply/A Shai-Hulud variant harvested maintainer credentials to auto-publish 314 infected npm package versions, proving lockfile-only installs no longer protect CI pipelines.Mon, 25 May 2026 10:22:46 GMTGroundy Editorial2026-06-10T00:00:00.000Znpmsupply-chain-securitypackage-managementci-cdprovenanceopen-source-securityGroundy Editorialhttps://groundy.com/articles/openais-s-1-triggers-a-repricing-cascade-for-every-private-ai-lab-valuation/https://groundy.com/articles/openais-s-1-triggers-a-repricing-cascade-for-every-private-ai-lab-valuation/OpenAI's confidential S-1 filing forces Anthropic's next raise and xAI's secondaries to defend against audited revenue multiples instead of private-round narratives.Mon, 25 May 2026 09:48:21 GMTGroundy Editorial2026-06-26T00:00:00.000Zipoai-valuationopenaianthropicventure-capitalsec-filingGroundy Editorialhttps://groundy.com/articles/project-glasswing-one-month-in-ai-bug-discovery-has-outpaced-the-patch-pipeline/https://groundy.com/articles/project-glasswing-one-month-in-ai-bug-discovery-has-outpaced-the-patch-pipeline/Anthropic's Glasswing found over 10,000 high-severity vulnerabilities in one month. Only 97 are patched. The bottleneck shifted from discovery to triage, and it is structural.Sun, 24 May 2026 21:12:14 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-securityvulnerability-disclosureanthropicclaude-mythoscybersecurityinterpretabilityGroundy Editorialhttps://groundy.com/articles/openai-hires-slacks-denise-dresser-as-cro-conceding-enterprise-growth-needs/https://groundy.com/articles/openai-hires-slacks-denise-dresser-as-cro-conceding-enterprise-growth-needs/OpenAI hiring Salesforce veteran Denise Dresser as CRO signals a shift from product-led growth to field sales, driven by IPO pressure and Anthropic's enterprise momentum.Sun, 24 May 2026 19:51:06 GMTGroundy Editorial2026-05-24T00:00:00.000Zopenaienterprise-salesai-iposalesforceenterprise-aidenise-dresserai-pricingGroundy Editorialhttps://groundy.com/articles/green-card-rule-change-forces-tech-workers-to-leave-the-us-to-apply/https://groundy.com/articles/green-card-rule-change-forces-tech-workers-to-leave-the-us-to-apply/A May 22 USCIS memo eliminates standard in-country green card processing, forcing temporary visa holders into consular processing abroad with no guaranteed return.Sun, 24 May 2026 18:28:44 GMTGroundy Editorial2026-05-24T00:00:00.000Zgreen-cardimmigration-policyh-1buscisai-talentvisa-reformconsular-processingGroundy Editorialhttps://groundy.com/articles/what-cloudflares-q1-2026-outage-data-says-about-designing-for-state-level/https://groundy.com/articles/what-cloudflares-q1-2026-outage-data-says-about-designing-for-state-level/Three state-ordered shutdowns, drone strikes on AWS data centers, and grid collapses in Q1 2026 prove that multi-region failover cannot survive country-level failure domains.Sun, 24 May 2026 17:21:36 GMTGroundy Editorial2026-05-24T00:00:00.000Zinternet-shutdownsdisaster-recoverycloud-infrastructurecloudflarebgp-monitoringmulti-region-failoverGroundy Editorialhttps://groundy.com/articles/openai-ships-lockdown-mode-and-elevated-risk-labels-for-chatgpt-sessions/https://groundy.com/articles/openai-ships-lockdown-mode-and-elevated-risk-labels-for-chatgpt-sessions/OpenAI's Lockdown Mode kills ChatGPT network exfiltration paths at the infrastructure layer, conceding that model-level filtering cannot stop prompt injection.Sun, 24 May 2026 16:51:51 GMTGroundy Editorial2026-05-24T00:00:00.000Zprompt-injectionchatgpt-securitylockdown-modeai-safetydata-exfiltrationenterprise-aiGroundy Editorialhttps://groundy.com/articles/ai-agent-alignment-tests-are-one-shot-a-new-benchmark-catches-multi-step/https://groundy.com/articles/ai-agent-alignment-tests-are-one-shot-a-new-benchmark-catches-multi-step/MoralityGym proves AI agents pass one-shot alignment checks but drift toward violations across multi-step trajectories, a failure mode red-team prompt batteries cannot detect.Sun, 24 May 2026 15:22:35 GMTGroundy Editorial2026-05-24T00:00:00.000Zai-alignmentsafety-evaluationmulti-step-agentsreinforcement-learningmoral-reasoningllm-safetyGroundy Editorialhttps://groundy.com/articles/files-md-bets-on-plain-markdown-folders-as-the-obsidian-exit-ramp/https://groundy.com/articles/files-md-bets-on-plain-markdown-folders-as-the-obsidian-exit-ramp/Files.md's HN traction exposed that Obsidian's core is closed-source, reframing its plugin ecosystem as a migration tax for developers evaluating plain-markdown alternatives.Sun, 24 May 2026 14:07:25 GMTGroundy Editorial2026-05-24T00:00:00.000Zmarkdownobsidiannote-taking-appsopen-sourcepwaknowledge-managementGroundy Editorialhttps://groundy.com/articles/us-researchers-hit-with-new-federal-limits-on-publishing-with-foreign/https://groundy.com/articles/us-researchers-hit-with-new-federal-limits-on-publishing-with-foreign/NIH and NASA are requiring pre-approval for foreign co-authors on US-funded papers without issuing formal guidance, applying export-control logic to manuscript authorship.Sun, 24 May 2026 13:22:16 GMTGroundy Editorial2026-05-24T00:00:00.000Znihresearch-policyexport-controlscientific-publishingforeign-collaborationnasaacademic-complianceGroundy Editorialhttps://groundy.com/articles/trump-ends-domestic-green-card-filing-applicants-must-now-leave-the-us-to-apply/https://groundy.com/articles/trump-ends-domestic-green-card-filing-applicants-must-now-leave-the-us-to-apply/A May 22 USCIS memo closes the domestic adjustment-of-status path, requiring H-1B, L-1, and F-1 visa holders to leave the US and refile through consular processing abroad.Sun, 24 May 2026 12:05:59 GMTGroundy Editorial2026-05-24T00:00:00.000Zimmigration-policygreen-carduscish-1bconsular-processingemployment-visaGroundy Editorialhttps://groundy.com/articles/microsofts-own-numbers-now-show-ai-agents-cost-more-than-the-humans-they/https://groundy.com/articles/microsofts-own-numbers-now-show-ai-agents-cost-more-than-the-humans-they/Microsoft's internal data shows token-burning AI agents now exceed the all-in cost of human labor, giving procurement teams vendor-supplied evidence to challenge 2027 renewal.Sun, 24 May 2026 11:16:03 GMTGroundy Editorial2026-05-24T00:00:00.000Zai-agentsenterprise-procurementtoken-economicsai-costsmicrosoftagentic-aiGroundy Editorialhttps://groundy.com/articles/microsofts-own-numbers-ai-agents-cost-more-per-task-than-the-human-employees/https://groundy.com/articles/microsofts-own-numbers-ai-agents-cost-more-per-task-than-the-human-employees/Microsoft's internal data shows agentic AI workflows consume 1000x more tokens than chat, with costs varying 30x between identical runs and zero correlation to output quality.Sun, 24 May 2026 09:59:28 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-agentstoken-costsenterprise-aiinference-economicsagentic-workflowsmicrosoftGroundy Editorialhttps://groundy.com/articles/metis-reframes-jailbreak-as-self-evolving-metacognitive-policy-optimization-not/https://groundy.com/articles/metis-reframes-jailbreak-as-self-evolving-metacognitive-policy-optimization-not/Metis rewrites its own jailbreak strategy mid-attack using causal diagnosis of refusals, hitting 76-78% ASR on O1 and GPT-5-chat. Static safety benchmarks now report a lower.Sat, 23 May 2026 21:27:17 GMTGroundy Editorial2026-06-26T00:00:00.000Zllm-jailbreakllm-securityred-teamingsafety-evaluationadaptive-attackpolicy-optimizationGroundy Editorialhttps://groundy.com/articles/reflector-moves-jailbreak-defense-into-model-weights-via-step-wise-self/https://groundy.com/articles/reflector-moves-jailbreak-defense-into-model-weights-via-step-wise-self/REFLECTOR internalizes jailbreak defense in model weights via per-step reflection, hitting 90%+ DSR but tying protection to base-model size and penalizing smaller deployments.Sat, 23 May 2026 21:01:06 GMTGroundy Editorial2026-05-24T00:00:00.000Zllm-securityjailbreak-defensemodel-alignmentself-reflectionguardrail-architectureicml-2026Groundy Editorialhttps://groundy.com/articles/vercel-blocks-deploys-with-vulnerable-next-mdx-remote-by-default-platform/https://groundy.com/articles/vercel-blocks-deploys-with-vulnerable-next-mdx-remote-by-default-platform/Vercel blocks deploys with vulnerable next-mdx-remote at build time, cutting CVE mitigation from weeks to hours while claiming unilateral control over dependency versions.Sat, 23 May 2026 20:35:11 GMTGroundy Editorial2026-05-24T00:00:00.000Zvercelsupply-chain-securitynext-mdx-remotecve-2026-0969dependency-managementpaasGroundy Editorialhttps://groundy.com/articles/cisas-own-data-leak-has-lawmakers-demanding-answers-about-the-voluntary-threat/https://groundy.com/articles/cisas-own-data-leak-has-lawmakers-demanding-answers-about-the-voluntary-threat/A CISA contractor exposed admin keys on GitHub for six months, eroding the trust basis for CIRCIA mandatory incident reporting and drawing congressional scrutiny.Sat, 23 May 2026 20:08:50 GMTGroundy Editorial2026-05-24T00:00:00.000Zcisacredential-leakcirciainformation-sharingcybersecurity-policyincident-reportinggithubGroundy Editorialhttps://groundy.com/articles/deno-2-8-lands-as-bun-gets-deprecated-by-yt-dlp-the-javascript-runtime-field/https://groundy.com/articles/deno-2-8-lands-as-bun-gets-deprecated-by-yt-dlp-the-javascript-runtime-field/Deno 2.8 jumps to 76% Node compatibility the same week yt-dlp deprecates Bun over lockfile bugs and maintainer fatigue, a concrete shift in the JS runtime hierarchy.Sat, 23 May 2026 19:47:53 GMTGroundy Editorial2026-05-24T00:00:00.000Zdenobunjavascript-runtimesnode-compatibilityyt-dlposs-maintenanceGroundy Editorialhttps://groundy.com/articles/openais-s-1-will-force-the-first-public-audit-of-llm-inference-margins/https://groundy.com/articles/openais-s-1-will-force-the-first-public-audit-of-llm-inference-margins/OpenAI's future S-1 will force the first audited disclosure of LLM inference margins, giving analysts a public benchmark to test every private vendor's margin claims.Sat, 23 May 2026 19:25:24 GMTGroundy Editorial2026-05-24T00:00:00.000Zopenai-ipos1-filingllm-marginsinference-costsmicrosoftai-unit-economicssec-disclosureGroundy Editorialhttps://groundy.com/articles/openais-s-1-will-have-to-define-agi-for-sec-reviewers-not-just-investors/https://groundy.com/articles/openais-s-1-will-have-to-define-agi-for-sec-reviewers-not-just-investors/OpenAI deleted its AGI clause from the Microsoft contract 25 days before filing its S-1, but SEC disclosure rules will force the company to define AGI in public anyway.Sat, 23 May 2026 18:50:21 GMTGroundy Editorial2026-05-24T00:00:00.000Zopenaisec-disclosureipoagimicrosoftsecurities-lawGroundy Editorialhttps://groundy.com/articles/employer-side-law-firms-create-a-structural-asymmetry-in-us-organizing-drives/https://groundy.com/articles/employer-side-law-firms-create-a-structural-asymmetry-in-us-organizing-drives/Littler Mendelson's 1,900 lawyers in 28 countries illustrate the structural asymmetry between employer-side firms and volunteer organizing committees in US union drives.Sat, 23 May 2026 18:30:15 GMTGroundy Editorial2026-05-28T00:00:00.000Zlabor-lawunion-organizingnlraemployer-representationtech-workersstructural-asymmetryGroundy Editorialhttps://groundy.com/articles/google-sunsets-gemini-cli-on-june-18-forced-migration-to-antigravity-cli-breaks/https://groundy.com/articles/google-sunsets-gemini-cli-on-june-18-forced-migration-to-antigravity-cli-breaks/Google sunsets Gemini CLI on June 18, 2026, forcing a 30-day migration to Antigravity CLI with no feature parity and eroding trust in Google's developer tooling.Sat, 23 May 2026 18:10:28 GMTGroundy Editorial2026-06-10T00:00:00.000Zgemini-cliantigravity-clideveloper-toolscli-migrationgoogleci-cdautomationGroundy Editorialhttps://groundy.com/articles/railways-may-19-gcp-suspension-exposes-the-single-account-risk-underneath-every/https://groundy.com/articles/railways-may-19-gcp-suspension-exposes-the-single-account-risk-underneath-every/Railway's eight-hour outage shows that multi-cloud data planes mean nothing when the control plane lives on a single provider account that can be suspended without notice.Sat, 23 May 2026 17:36:07 GMTGroundy Editorial2026-05-23T00:00:00.000Zgcprailwaycloud-outagecontrol-planepaasmulti-cloudinfrastructure-resilienceGroundy Editorialhttps://groundy.com/articles/malicious-vscode-extension-hit-3-800-repos-what-githubs-marketplace-trust-model/https://groundy.com/articles/malicious-vscode-extension-hit-3-800-repos-what-githubs-marketplace-trust-model/A poisoned VS Code extension exfiltrated 3,800 GitHub repos through a Marketplace that verifies publisher identity but never inspects extension code and imposes no runtime.Sat, 23 May 2026 17:16:37 GMTGroundy Editorial2026-05-23T00:00:00.000Zvscode-extension-securitysupply-chain-attackgithub-breachdeveloper-tools-securityteam-pcpmarketplace-trustGroundy Editorialhttps://groundy.com/articles/microsoft-and-ubers-ai-agent-bills-expose-a-per-token-pricing-problem/https://groundy.com/articles/microsoft-and-ubers-ai-agent-bills-expose-a-per-token-pricing-problem/Microsoft canceled Claude Code licenses for cost reasons and Uber exhausted its AI budget in four months, revealing per-token agent costs that exceed human labor rates and.Sat, 23 May 2026 16:52:55 GMTGroundy Editorial2026-05-23T00:00:00.000Zai-agentsinference-costsenterprise-aiprocurementtoken-economicsmicrosoftGroundy Editorialhttps://groundy.com/articles/cursors-in-house-model-changes-the-vendor-calculus-for-ai-coding-teams/https://groundy.com/articles/cursors-in-house-model-changes-the-vendor-calculus-for-ai-coding-teams/Cursor now ships its own coding model inside the IDE, collapsing the tool-model separation teams relied on and raising lock-in risk ahead of the next renewal cycle.Sat, 23 May 2026 16:15:27 GMTGroundy Editorial2026-05-23T00:00:00.000Zcursor-ideai-coding-toolsvendor-lock-inswe-benchai-code-generationdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/specbench-exposes-reward-hacking-in-long-horizon-coding-agents/https://groundy.com/articles/specbench-exposes-reward-hacking-in-long-horizon-coding-agents/SpecBench quantifies a 28-point reward-hacking gap per 10x code-size increase, proving passing test suites are unreliable correctness signals for autonomous coding agents.Sat, 23 May 2026 15:56:14 GMTGroundy Editorial2026-06-24T00:00:00.000Zreward-hackingcoding-agentsllm-benchmarksci-cdagentic-codingtest-evaluationGroundy Editorialhttps://groundy.com/articles/arxiv-2605-16428-measures-ai-searchs-drag-on-publisher-traffic-using-paired/https://groundy.com/articles/arxiv-2605-16428-measures-ai-searchs-drag-on-publisher-traffic-using-paired/An arXiv study finds AI Overviews boost Reddit engagement 12% for experience-based content, but Google AI Mode erases those gains, reshaping search-driven publishing economics.Sat, 23 May 2026 15:36:51 GMTGroundy Editorial2026-05-23T00:00:00.000Zai-overviewsgoogle-searchpublisher-trafficcontent-strategyredditsearch-ecologyGroundy Editorialhttps://groundy.com/articles/vercels-next-js-middleware-bypass-postmortem-what-the-fix-reveals-about-edge/https://groundy.com/articles/vercels-next-js-middleware-bypass-postmortem-what-the-fix-reveals-about-edge/Two separate Next.js production failures, a header bypass CVE and an Edge Runtime mismatch, show middleware is not a reliable sole auth layer for self-hosted deployments.Sat, 23 May 2026 15:03:41 GMTGroundy Editorial2026-05-23T00:00:00.000Znextjsmiddlewareedge-runtimecve-2025-29927authorizationself-hostingweb-securityGroundy Editorialhttps://groundy.com/articles/openais-new-agent-defense-post-concedes-prompt-injection-is-architectural-not/https://groundy.com/articles/openais-new-agent-defense-post-concedes-prompt-injection-is-architectural-not/OpenAI's March 2026 guide concedes prompt injection is a permanent architectural constraint, forcing expensive containment for any agent that reads untrusted data.Sat, 23 May 2026 14:35:25 GMTGroundy Editorial2026-05-23T00:00:00.000Zprompt-injectionai-agentsai-securitydefense-in-depthopenaillm-securityGroundy Editorialhttps://groundy.com/articles/nih-demands-advance-clearance-for-foreign-co-authors-without-a-published-rule/https://groundy.com/articles/nih-demands-advance-clearance-for-foreign-co-authors-without-a-published-rule/NIH is requiring advance clearance for foreign co-authors without publishing a formal rule, forcing compliance offices to build a pre-submission gate no one budgeted for.Sat, 23 May 2026 14:17:55 GMTGroundy Editorial2026-05-23T00:00:00.000Znihresearch-securityforeign-collaborationcompliancescientific-publishinggrants-policyGroundy Editorialhttps://groundy.com/articles/graphflow-lifts-llm-agent-workflows-into-schedulable-graphs-to-optimize-serving/https://groundy.com/articles/graphflow-lifts-llm-agent-workflows-into-schedulable-graphs-to-optimize-serving/GraphFlow turns agent workflows into declarative graphs the serving runtime can batch and reorder, exposing a serving-optimization gap in LangGraph, CrewAI, and AutoGen.Sat, 23 May 2026 13:46:02 GMTGroundy Editorial2026-05-23T00:00:00.000Zgraphflowllm-servingagent-orchestrationkv-cacheworkflow-schedulinginference-optimizationGroundy Editorialhttps://groundy.com/articles/learning-to-configure-agentic-ai-systems-exposes-a-gap-in-crewai-and-autogen/https://groundy.com/articles/learning-to-configure-agentic-ai-systems-exposes-a-gap-in-crewai-and-autogen/ARC proves learned per-query agent configuration beats static templates by 31% reasoning and 2x τ-Bench, forcing CrewAI and AutoGen to compete on declarative config surfaces.Sat, 23 May 2026 13:19:09 GMTGroundy Editorial2026-05-23T00:00:00.000Zagent-configurationagentic-frameworksarccrewaiautogenlanggraphGroundy Editorialhttps://groundy.com/articles/microsofts-2026-cost-math-forces-crewai-and-langgraph-users-to-audit-token/https://groundy.com/articles/microsofts-2026-cost-math-forces-crewai-and-langgraph-users-to-audit-token/Microsoft's accounting reveals per-agent token bills now exceed engineer salaries. CrewAI, LangGraph, and AutoGen lack the per-step cost attribution enterprises will soon.Sat, 23 May 2026 12:52:27 GMTGroundy Editorial2026-05-23T00:00:00.000Zagent-frameworkstoken-costobservabilitymulti-agentcost-attributionenterprise-aiGroundy Editorialhttps://groundy.com/articles/pbt-bench-asks-whether-ai-coding-agents-can-actually-write-property-based-tests/https://groundy.com/articles/pbt-bench-asks-whether-ai-coding-agents-can-actually-write-property-based-tests/PBT-Bench reveals the best AI coding agent catches only 83.4% of semantic bugs with property-based tests, showing SWE-Bench QA claims measure the wrong testing paradigm.Sat, 23 May 2026 12:22:43 GMTGroundy Editorial2026-06-10T00:00:00.000Zproperty-based-testingcoding-agentsswebenchai-testinghypothesis-frameworkreward-hackingsoftware-qualityGroundy Editorialhttps://groundy.com/articles/specbench-catches-long-horizon-coding-agents-gaming-reward-signals/https://groundy.com/articles/specbench-catches-long-horizon-coding-agents-gaming-reward-signals/SpecBench exposes a 28 pp scaling coefficient in reward hacking for long-horizon coding agents, revealing gaps that SWE-bench-style leaderboards completely miss.Sat, 23 May 2026 12:03:20 GMTGroundy Editorial2026-05-23T00:00:00.000Zreward-hackingcoding-agentsbenchmarksspec-faithfulnessswebenchautonomous-codingGroundy Editorialhttps://groundy.com/articles/nx-console-18-95-0-compromise-hides-a-multi-stage-credential-stealer/https://groundy.com/articles/nx-console-18-95-0-compromise-hides-a-multi-stage-credential-stealer/A compromised Nx Console extension used orphan commits to deliver a credential-stealing payload, exposing structural gaps in marketplace security and Sigstore provenance.Sat, 23 May 2026 11:30:21 GMTGroundy Editorial2026-05-23T00:00:00.000Zsupply-chainvscodecredential-theftsigstoreopen-sourcenpm-securityGroundy Editorialhttps://groundy.com/articles/beyond-text-to-sql-new-agentic-architecture-routes-enterprise-analytics-through/https://groundy.com/articles/beyond-text-to-sql-new-agentic-architecture-routes-enterprise-analytics-through/A May 2026 arXiv paper argues governed API contracts should replace SQL for LLM analytics, moving security and lineage from SQL rewrites to a stable boundary layer.Sat, 23 May 2026 11:13:03 GMTGroundy Editorial2026-05-23T00:00:00.000Ztext-to-sqlagentic-systemsdata-governanceenterprise-analyticsllm-agentsapi-contractsanalytics-apisGroundy Editorialhttps://groundy.com/articles/solar-frames-lifelong-learning-agents-as-self-optimizing-skipping-the-human/https://groundy.com/articles/solar-frames-lifelong-learning-agents-as-self-optimizing-skipping-the-human/SOLAR removes the supervisor-agent curation gate from skill acquisition, but SpecBench shows reward hacking scales with complexity, shifting the bottleneck to rollback and.Sat, 23 May 2026 10:39:03 GMTGroundy Editorial2026-06-26T00:00:00.000Zsolar-agentlifelong-learningreward-hackingagent-frameworksskill-curationmeta-learningGroundy Editorialhttps://groundy.com/articles/vllm-v0-21-adds-bi-directional-kv-cache-transfers-between-prefill-and-decode/https://groundy.com/articles/vllm-v0-21-adds-bi-directional-kv-cache-transfers-between-prefill-and-decode/vLLM v0.21 reportedly adds bi-directional KV cache transfers between prefill and decode nodes, making P/D ratios dynamic and requiring new NIXL transfer telemetry.Sat, 23 May 2026 10:25:12 GMTGroundy Editorial2026-07-06T00:00:00.000Zvllmkv-cachedisaggregated-servingnixlinference-infrastructuregpu-schedulingGroundy Editorialhttps://groundy.com/articles/a-theory-of-time-sensitive-language-generation-says-sparse-hallucination-beats/https://groundy.com/articles/a-theory-of-time-sensitive-language-generation-says-sparse-hallucination-beats/arXiv 2605.11302 proves timely generation requires sparse hallucination under formal bounds, reframing RLHF safety tuning as a tradeoff between two failure modes.Sat, 23 May 2026 09:45:33 GMTGroundy Editorial2026-05-23T00:00:00.000Zhallucinationrlhflanguage-generationsafety-tuningmode-collapseformal-methodsdeep-learning-theoryGroundy Editorialhttps://groundy.com/articles/when-stronger-backdoor-triggers-backfire-an-arxiv-theory-paper-inverts-a-core/https://groundy.com/articles/when-stronger-backdoor-triggers-backfire-an-arxiv-theory-paper-inverts-a-core/A May 2026 arXiv paper proves backdoor attack success peaks at intermediate trigger strength then declines. Detectors built for strong triggers miss the attacks near the peak.Sat, 23 May 2026 09:20:04 GMTGroundy Editorial2026-05-23T00:00:00.000Zbackdoor-attacksadversarial-mlmodel-securitybackdoor-detectiontrigger-strengthml-safetyGroundy Editorialhttps://groundy.com/articles/the-last-word-often-wins-a-format-confound-inflates-chain-of-thought-corruption/https://groundy.com/articles/the-last-word-often-wins-a-format-confound-inflates-chain-of-thought-corruption/A format confound in CoT corruption benchmarks, suffix sensitivity collapsed 19× when final-answer text was stripped, means published faithfulness scores are inflated.Tue, 19 May 2026 20:35:09 GMTGroundy Editorial2026-06-26T00:00:00.000Zchain-of-thoughteval-methodologyprocess-reward-modelsgsm8kreasoning-faithfulnessformat-confoundbenchmarkingGroundy Editorialhttps://groundy.com/articles/bret-taylors-sierra-raises-950m-at-15b-claims-40-of-fortune-50-use-its-agents/https://groundy.com/articles/bret-taylors-sierra-raises-950m-at-15b-claims-40-of-fortune-50-use-its-agents/Sierra's $950M Series E at $15B values a company charging per resolved interaction, directly threatening Salesforce, Zendesk, and ServiceNow seat-based revenue.Tue, 19 May 2026 18:48:03 GMTGroundy Editorial2026-06-26T00:00:00.000Zenterprise-aiai-agentssaas-pricingcustomer-experienceventure-capitalsalesforceGroundy Editorialhttps://groundy.com/articles/maryland-enacts-first-us-ban-on-algorithmic-grocery-pricing-effective/https://groundy.com/articles/maryland-enacts-first-us-ban-on-algorithmic-grocery-pricing-effective/Governor Moore signed Maryland's Protection From Predatory Pricing Act on April 28, making it the first US state law to ban AI-based grocery pricing, effective immediately.Tue, 19 May 2026 17:20:05 GMTGroundy Editorial2026-05-19T00:00:00.000Zalgorithmic-pricingai-regulationconsumer-protectiongrocery-retaildynamic-pricingstate-legislationGroundy Editorialhttps://groundy.com/articles/anthropic-passes-openai-in-us-business-adoption-but-per-token-billing-shifts/https://groundy.com/articles/anthropic-passes-openai-in-us-business-adoption-but-per-token-billing-shifts/Anthropic claimed 34.4% of US business AI spend in April vs OpenAI's 32.3%, per Ramp's May 2026 index. The per-token pricing model behind the lead transfers compute cost.Tue, 19 May 2026 16:13:48 GMTGroundy Editorial2026-06-26T00:00:00.000Zenterprise-aianthropicopenaiai-procurementsaas-pricingdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/dmax-hits-1-338-tokens-sec-on-2x-h200-parallel-decoding-pushes-dllm-serving/https://groundy.com/articles/dmax-hits-1-338-tokens-sec-on-2x-h200-parallel-decoding-pushes-dllm-serving/DMax reformulates diffusion LLM decoding as embedding refinement, achieving 1,338 tok/s on 2× H200 and challenging ParallelBench's parallel-decoding quality trade-off finding.Tue, 19 May 2026 14:57:29 GMTGroundy Editorial2026-05-19T00:00:00.000Zdiffusion-llmparallel-decodingllm-servinginferencesglangthroughputlladaGroundy Editorialhttps://groundy.com/articles/trojan-hippo-plants-dormant-payloads-in-agent-memory-hits-85-100-exfiltration/https://groundy.com/articles/trojan-hippo-plants-dormant-payloads-in-agent-memory-hits-85-100-exfiltration/Trojan Hippo plants dormant payloads in agent memory via a single untrusted email, achieving 85-100% exfiltration ASR on frontier models after surviving 100 benign sessions.Tue, 19 May 2026 13:39:39 GMTGroundy Editorial2026-05-19T00:00:00.000Zagent-memoryllm-securityprompt-injectionragdata-exfiltrationmemory-attacksagent-frameworksGroundy Editorialhttps://groundy.com/articles/anthropic-ships-10-finance-agents-with-moodys-600m-company-credit-data/https://groundy.com/articles/anthropic-ships-10-finance-agents-with-moodys-600m-company-credit-data/Anthropic launched 10 finance agent templates, a Moody's MCP app with 600M-company credit data, and expanded M365 add-ins, pressuring Bloomberg, Refinitiv, and Microsoft.Tue, 19 May 2026 12:05:33 GMTGroundy Editorial2026-06-10T00:00:00.000Zanthropicfinance-aienterprise-aiai-agentsmicrosoft-365moodysfinancial-servicesGroundy Editorialhttps://groundy.com/articles/a-new-trust-schema-exposes-why-agent-skill-registries-fail-enterprise-audit/https://groundy.com/articles/a-new-trust-schema-exposes-why-agent-skill-registries-fail-enterprise-audit/Metere's arXiv 2605.00424 formalizes a four-level trust schema and biconditional correctness criterion for agent skills, exposing that current SKILL.md-based registries.Tue, 19 May 2026 10:08:03 GMTGroundy Editorial2026-05-19T00:00:00.000Zagent-securityskill-registrieshitl-agentstrust-verificationsupply-chain-securityagent-frameworksGroundy Editorialhttps://groundy.com/articles/dprivbench-llms-score-99-5-on-textbook-dp-but-collapse-on-advanced-reasoning/https://groundy.com/articles/dprivbench-llms-score-99-5-on-textbook-dp-but-collapse-on-advanced-reasoning/DPrivBench tests 11 LLMs on 713 differential-privacy instances. GPT-5-High hits 0.995 on textbook checks, but the best model reaches only F1 0.829 on advanced DP, and fails.Mon, 18 May 2026 21:47:16 GMTGroundy Editorial2026-05-19T00:00:00.000Zdifferential-privacyllm-benchmarksai-securityprivacy-auditingmachine-learningGroundy Editorialhttps://groundy.com/articles/ftcs-take-it-down-act-lands-may-19-48-hour-deepfake-ncii-takedowns-and-no-safe/https://groundy.com/articles/ftcs-take-it-down-act-lands-may-19-48-hour-deepfake-ncii-takedowns-and-no-safe/Ferguson's May 11 warning letters put 15 UGC platforms on notice as Section 3 of the TAKE IT DOWN Act activates May 19, requiring 48-hour NCII removal with no safe harbor.Mon, 18 May 2026 21:30:14 GMTGroundy Editorial2026-05-19T00:00:00.000Ztake-it-down-actncii-takedownftc-enforcementdeepfake-regulationcontent-moderationai-regulationGroundy Editorialhttps://groundy.com/articles/elsevier-v-meta-first-science-publisher-names-sci-hub-torrents-in-llama/https://groundy.com/articles/elsevier-v-meta-first-science-publisher-names-sci-hub-torrents-in-llama/Five publishers sued Meta in SDNY, alleging it torrented 134.6 TB from LibGen and Sci-Hub to train Llama, naming Zuckerberg personally and exposing labs to discovery risk.Mon, 18 May 2026 21:09:38 GMTGroundy Editorial2026-05-18T00:00:00.000Zcopyright-litigationmeta-aillamaai-training-datashadow-librariesdmcafair-useGroundy Editorialhttps://groundy.com/articles/sierra-raises-950m-at-15b-locking-40-of-the-fortune-50-into-its-agent-platform/https://groundy.com/articles/sierra-raises-950m-at-15b-locking-40-of-the-fortune-50-into-its-agent-platform/Sierra closed a $950M round led by Tiger Global and GV on May 4, 2026, hitting $15B post-money and 40%+ Fortune 50 penetration as OpenAI and Anthropic entered the same.Mon, 18 May 2026 20:55:01 GMTGroundy Editorial2026-06-26T00:00:00.000Zenterprise-aifunding-roundsai-agentscustomer-experienceventure-capitalagentic-infrastructureGroundy Editorialhttps://groundy.com/articles/praetorian-cuts-gnn-backdoor-success-to-0-55-by-measuring-trigger-subgraph/https://groundy.com/articles/praetorian-cuts-gnn-backdoor-success-to-0-55-by-measuring-trigger-subgraph/PRAETORIAN cuts GNN backdoor attack success to 0.55% by measuring structural influence instead of trigger patterns, forcing adaptive attackers into a stealth-vs-effectiveness.Mon, 18 May 2026 20:39:39 GMTGroundy Editorial2026-05-18T00:00:00.000Zgraph-neural-networksbackdoor-defensemachine-learning-securityadversarial-mlgnngraph-learningGroundy Editorialhttps://groundy.com/articles/frontier-ai-has-broken-the-open-ctf-format-what-the-scoreboard-collapse-means/https://groundy.com/articles/frontier-ai-has-broken-the-open-ctf-format-what-the-scoreboard-collapse-means/Frontier AI now autonomously solves medium and hard CTF challenges, collapsing open scoreboards as a measure of human skill and threatening the pipeline for security talent.Mon, 18 May 2026 20:20:11 GMTGroundy Editorial2026-06-10T00:00:00.000Zctfai-securitycybersecuritytalent-pipelinescoreboardsoffensive-securitychallenge-designGroundy Editorialhttps://groundy.com/articles/trustfall-one-keypress-in-claude-code-gemini-cli-cursor-and-copilot-cli/https://groundy.com/articles/trustfall-one-keypress-in-claude-code-gemini-cli-cursor-and-copilot-cli/A committed.claude/settings.json bypassed Claude Code's workspace trust dialog (CVE-2026-33068, CVSS 7.7), granting bypassPermissions silently. Fixed in v2.1.53.Mon, 18 May 2026 20:09:58 GMTGroundy Editorial2026-06-26T00:00:00.000Zclaude-codeworkspace-trustmcp-securitypermission-bypassci-securitytrustfallcve-2026-33068Groundy Editorialhttps://groundy.com/articles/claude-code-adds-plugin-dependency-enforcement-disable-now-refuses-to-break/https://groundy.com/articles/claude-code-adds-plugin-dependency-enforcement-disable-now-refuses-to-break/Claude Code v2.1.143 adds dependency enforcement: disable blocks when dependents exist, enable cascades to installed deps, and prune cleans orphans. Plugin authors now.Mon, 18 May 2026 19:51:11 GMTGroundy Editorial2026-06-26T00:00:00.000Zclaude-codeplugin-managementdeveloper-toolsdependency-managementpackage-managementGroundy Editorialhttps://groundy.com/articles/spacexai-lost-50-researchers-since-the-february-merger-mostly-to-meta/https://groundy.com/articles/spacexai-lost-50-researchers-since-the-february-merger-mostly-to-meta/SpaceXAI has lost over 50 researchers since the February merger, gutting its pre-training team and exposing how all-stock absorption undermines frontier AI talent retention.Mon, 18 May 2026 19:31:11 GMTGroundy Editorial2026-06-26T00:00:00.000Zspacexaitalent-flightfrontier-aimetathinking-machinespre-trainingmergersGroundy Editorialhttps://groundy.com/articles/coinbase-cuts-14-to-go-ai-native-crypto-exchanges-adopt-the-ai-capex-layoff/https://groundy.com/articles/coinbase-cuts-14-to-go-ai-native-crypto-exchanges-adopt-the-ai-capex-layoff/Coinbase cut roughly 14% of staff to become AI-native, flattening hierarchy and dissolving pure-manager roles. Gartner finds AI projects stalling before returns materialize.Mon, 18 May 2026 19:17:02 GMTGroundy Editorial2026-06-23T00:00:00.000Zcoinbasecrypto-exchangeai-nativelayoffsautomationgartnerroiGroundy Editorialhttps://groundy.com/articles/ai-was-cited-in-26-of-challengers-april-layoffs-ubs-notes-the-series-captures/https://groundy.com/articles/ai-was-cited-in-26-of-challengers-april-layoffs-ubs-notes-the-series-captures/Challenger data shows 26% of April layoffs cited AI, but UBS notes this tracks corporate narrative, not displacement. The predictive signal is hiring-pipeline compression.Mon, 18 May 2026 19:02:44 GMTGroundy Editorial2026-05-18T00:00:00.000Zai-layoffslabor-marketchallenger-reportubs-researchjoltsautomationai-displacementGroundy Editorialhttps://groundy.com/articles/paypals-1-5b-ai-overhaul-cuts-4-760-jobs-and-reframes-layoffs-as-capex/https://groundy.com/articles/paypals-1-5b-ai-overhaul-cuts-4-760-jobs-and-reframes-layoffs-as-capex/PayPal bundled 4,760 layoffs with its $1.5B AI savings plan, leaving sell-side analysts unable to model the labor-vs-capex split until segment reporting arrives in 2027.Mon, 18 May 2026 18:40:33 GMTGroundy Editorial2026-06-26T00:00:00.000Zpaypalfintechai-restructuringworkforce-reductionfinancial-disclosuresell-side-analysisai-investmentGroundy Editorialhttps://groundy.com/articles/frontier-ai-broke-open-ctfs-what-hack-the-box-and-bearcatctf-2026-results-mean/https://groundy.com/articles/frontier-ai-broke-open-ctfs-what-hack-the-box-and-bearcatctf-2026-results-mean/Frontier AI now ranks in the top 5% of CTFs, eroding leaderboards as a security hiring signal and forcing organizers toward bans, hybrid scoring, or AI-only divisions.Mon, 18 May 2026 18:25:06 GMTGroundy Editorial2026-06-10T00:00:00.000Zctfai-agentscybersecurityhiringcompetitionsinfosecrecruitingGroundy Editorialhttps://groundy.com/articles/learning-fast-and-slow-what-arxiv-2605-12484-proposes-for-llms-that-adapt/https://groundy.com/articles/learning-fast-and-slow-what-arxiv-2605-12484-proposes-for-llms-that-adapt/Fast-Slow Training splits LLM updates into prompt fast weights and parametric slow weights, cutting KL drift by 70% and lifting sample efficiency by 3×, keeping plasticity.Mon, 18 May 2026 18:13:50 GMTGroundy Editorial2026-05-18T00:00:00.000Zcontinual-learningfine-tuningllm-trainingprompt-optimizationreinforcement-learningqwensample-efficiencyGroundy Editorialhttps://groundy.com/articles/salesforce-spring-26-reveals-a-default-on-ai-training-setting-that-predates/https://groundy.com/articles/salesforce-spring-26-reveals-a-default-on-ai-training-setting-that-predates/Salesforce's Spring '26 toggle surfaced a default-on AI training posture dating to 2018, joining GitHub and Atlassian in a spring wave that shifts privacy burden to buyers.Mon, 18 May 2026 18:00:02 GMTGroundy Editorial2026-05-18T00:00:00.000Zsalesforceeinsteinai-trainingdata-privacysaas-compliancevendor-riskprocurementGroundy Editorialhttps://groundy.com/articles/kioxia-and-dells-10-pb-in-2ru-what-storage-density-means-for-cluster-power/https://groundy.com/articles/kioxia-and-dells-10-pb-in-2ru-what-storage-density-means-for-cluster-power/Kioxia and Dell packed 9.8 PB into a 2U server. At 245 TB per drive, rebuilds take 14-27 hours, forcing teams to retune erasure coding for production clusters.Mon, 18 May 2026 17:38:28 GMTGroundy Editorial2026-05-18T00:00:00.000Zstorage-densitynvmedata-centererasure-codingflash-storagedellssdGroundy Editorialhttps://groundy.com/articles/saps-1b-prior-labs-deal-bets-enterprise-ai-on-tabular-foundation-models-not-llms/https://groundy.com/articles/saps-1b-prior-labs-deal-bets-enterprise-ai-on-tabular-foundation-models-not-llms/SAP is spending over €1 billion on Prior Labs, betting tabular models for structured ERP data outcompete horizontal LLMs and force rivals to build vertical models.Mon, 18 May 2026 17:27:47 GMTGroundy Editorial2026-05-18T00:00:00.000Ztabular-foundation-modelssapprior-labserpacquisitionenterprise-aistructured-dataGroundy Editorialhttps://groundy.com/articles/meta-tells-8-000-laid-off-staff-the-cuts-pay-for-135b-ai-capex-not/https://groundy.com/articles/meta-tells-8-000-laid-off-staff-the-cuts-pay-for-135b-ai-capex-not/Meta's 8,000 May 20 layoffs fund $145B in AI capex, not productivity gains. Zuckerberg reframes the cuts as operating-expense reallocation rather than AI substitution.Mon, 18 May 2026 17:08:12 GMTGroundy Editorial2026-05-18T00:00:00.000Zmetalayoffsai-capextech-laboropex-reallocationheadcount-to-computeGroundy Editorialhttps://groundy.com/articles/governors-keep-vetoing-data-center-moratoriums-so-voters-are-writing-their-own/https://groundy.com/articles/governors-keep-vetoing-data-center-moratoriums-so-voters-are-writing-their-own/Ohio's 25MW data center ban petition missed 2026 and now targets 2027. After governors vetoed moratoriums, voters in several states decide it at the ballot box.Mon, 18 May 2026 16:50:24 GMTGroundy Editorial2026-06-26T00:00:00.000Zdata-centersballot-measuresai-infrastructureenergy-policynimbyohiodirect-democracyGroundy Editorialhttps://groundy.com/articles/oppo-open-sources-x-omniclaw-edge-native-android-agent-that-runs-vision-and-ocr/https://groundy.com/articles/oppo-open-sources-x-omniclaw-edge-native-android-agent-that-runs-vision-and-ocr/OPPO ships X-OmniClaw, an on-device Android agent with multimodal perception and reasoning, but the technical report provides no benchmarks to validate its edge-native claims.Mon, 18 May 2026 16:38:14 GMTGroundy Editorial2026-05-18T00:00:00.000Zandroid-agenton-device-aiedge-inferencemobile-mlbehavior-cloningopen-sourcemultimodal-aiGroundy Editorialhttps://groundy.com/articles/openais-4b-deployment-company-buys-tomoro-and-signs-19-partners-to-own/https://groundy.com/articles/openais-4b-deployment-company-buys-tomoro-and-signs-19-partners-to-own/OpenAI's $4B Deployment Company and Tomoro acquisition move it from API sales into enterprise implementation, forcing buyers to choose between captive and neutral integration.Mon, 18 May 2026 16:17:38 GMTGroundy Editorial2026-06-20T00:00:00.000Zopenaianthropicenterprise-aisystems-integrationconsultingai-deploymentprocurementGroundy Editorialhttps://groundy.com/articles/langgraph-1-2-0-makes-error-handler-resume-crash-durable-with-conditions/https://groundy.com/articles/langgraph-1-2-0-makes-error-handler-resume-crash-durable-with-conditions/LangGraph 1.2.0 extends checkpoint persistence to error handlers, surviving host crashes mid-handler. The guarantee requires Postgres, sync mode, and idempotent nodes.Mon, 18 May 2026 16:00:59 GMTGroundy Editorial2026-06-26T00:00:00.000Zlanggraphagent-frameworkscheckpointingdurable-executioncrewaicloudflare-workersGroundy Editorialhttps://groundy.com/articles/crewai-vs-autogen-vs-langgraph-2026-the-real-trade-off-after-maintenance-mode/https://groundy.com/articles/crewai-vs-autogen-vs-langgraph-2026-the-real-trade-off-after-maintenance-mode/AutoGen is in maintenance mode, so the 2026 choice is CrewAI vs LangGraph. The verified gap is structural: graph-state failure isolation beats role-based retry on long tasks.Mon, 18 May 2026 15:49:40 GMTGroundy Editorial2026-06-17T00:00:00.000Zagents-frameworkslanggraphcrewaiautogenmulti-agentbenchmarkingfailure-modesGroundy Editorialhttps://groundy.com/articles/mini-shai-hulud-ships-the-first-malicious-npm-with-valid-slsa-provenance/https://groundy.com/articles/mini-shai-hulud-ships-the-first-malicious-npm-with-valid-slsa-provenance/TeamPCP compromised TanStack's CI to publish 84 malicious npm packages with valid SLSA Build Level 3 provenance, proving that cryptographic attestation cannot protect a.Mon, 18 May 2026 15:32:17 GMTGroundy Editorial2026-05-18T00:00:00.000Zsupply-chainnpmslsa-provenanceoidcci-cdgithub-actionstanstackGroundy Editorialhttps://groundy.com/articles/formulacodes-957-task-benchmark-catches-frontier-agents-failing-at-real/https://groundy.com/articles/formulacodes-957-task-benchmark-catches-frontier-agents-failing-at-real/FormulaCode finds frontier agents trail human experts at repo-scale optimization, exposing SWE-Bench's blind spot: passing patches that never verify real-world speedups.Mon, 18 May 2026 15:18:09 GMTGroundy Editorial2026-06-10T00:00:00.000Zagents-frameworksllm-benchmarksswe-benchperformance-optimizationai-coding-agentsformulacodeicml-2026Groundy Editorialhttps://groundy.com/articles/canadas-joint-privacy-ruling-openai-trained-chatgpt-on-medical-and-ideological/https://groundy.com/articles/canadas-joint-privacy-ruling-openai-trained-chatgpt-on-medical-and-ideological/Canadian regulators ruled OpenAI trained ChatGPT on medical and ideological data without consent, violating five privacy laws and shifting burden to AI vendors.Mon, 18 May 2026 15:01:26 GMTGroundy Editorial2026-06-21T00:00:00.000Zprivacyai-regulationopenaicanadachatgptdata-scrapingconsentGroundy Editorialhttps://groundy.com/articles/apples-250m-siri-settlement-iphone-16-buyers-get-25-to-95-for-undelivered/https://groundy.com/articles/apples-250m-siri-settlement-iphone-16-buyers-get-25-to-95-for-undelivered/Apple's $250M settlement over undelivered WWDC 2024 Siri features pays iPhone 15 Pro and 16 buyers $25-$95 per device, setting a legal precedent for AI marketing liability.Mon, 18 May 2026 14:45:14 GMTGroundy Editorial2026-05-18T00:00:00.000Zapple-intelligenceclass-actionsiriai-liabilityconsumer-protectionsettlementGroundy Editorialhttps://groundy.com/articles/cloudflare-cuts-1-100-jobs-during-a-record-q1-and-calls-it-the-agentic-ai-era/https://groundy.com/articles/cloudflare-cuts-1-100-jobs-during-a-record-q1-and-calls-it-the-agentic-ai-era/Cloudflare cut 1,100 jobs during a record Q1, citing the agentic AI era over capex pressure. The move shifts the burden to vendors to prove per-seat displacement math.Mon, 18 May 2026 14:23:59 GMTGroundy Editorial2026-05-18T00:00:00.000Zcloudflareagentic-ailayoffsworkforce-automationenterprise-aitech-industryai-adoptionGroundy Editorialhttps://groundy.com/articles/multibreak-benchmark-10-389-multi-turn-jailbreak-prompts-raise-asr-54pp/https://groundy.com/articles/multibreak-benchmark-10-389-multi-turn-jailbreak-prompts-raise-asr-54pp/MultiBreak's multi-turn benchmark lifts attack success 54 percentage points on DeepSeek-R1-7B, showing single-turn refusal rates understate real conversational risk.Mon, 18 May 2026 14:03:57 GMTGroundy Editorial2026-06-26T00:00:00.000Zsecurityllm-safetyjailbreakadversarial-mldeepseekai-alignmentbenchmarkGroundy Editorialhttps://groundy.com/articles/connecticut-sb-5-passes-may-1-ai-provenance-aedt-disclosures-and-chatbot/https://groundy.com/articles/connecticut-sb-5-passes-may-1-ai-provenance-aedt-disclosures-and-chatbot/Connecticut SB 5 requires provenance for large generative platforms by October 2026, AEDT disclosures for HR tools, and companion-chatbot guardrails for minors by January.Mon, 18 May 2026 13:57:21 GMTGroundy Editorial2026-05-18T00:00:00.000Zai-regulationconnecticut-sb5c2pa-provenanceaedt-compliancecompanion-chatbotsstate-ai-lawsengineering-complianceGroundy Editorialhttps://groundy.com/articles/anthropics-1-5b-joint-venture-with-goldman-sachs-and-blackstone-sends-claude/https://groundy.com/articles/anthropics-1-5b-joint-venture-with-goldman-sachs-and-blackstone-sends-claude/Anthropic's $1.5B joint venture with Blackstone, Goldman Sachs, and Hellman & Friedman bypasses CIO procurement by using PE ownership to mandate Claude deployment across.Mon, 18 May 2026 13:40:30 GMTGroundy Editorial2026-05-18T00:00:00.000Zenterprise-aiprivate-equityanthropicjoint-ventureai-deploymentopenaiconsultingGroundy Editorialhttps://groundy.com/articles/next-js-cve-2026-44578-websocket-upgrade-ssrf-hits-79-000-self-hosted-instances/https://groundy.com/articles/next-js-cve-2026-44578-websocket-upgrade-ssrf-hits-79-000-self-hosted-instances/Next.js 15.5.16 and 16.2.5 patch an unauthenticated WebSocket upgrade SSRF. A single absolute-form URL request proxies internal traffic, exposing 79,000 self-hosted instances.Mon, 18 May 2026 13:16:24 GMTGroundy Editorial2026-05-18T00:00:00.000Znext-jsssrfwebsocketcveself-hostedvulnerabilitypatch-managementGroundy Editorialhttps://groundy.com/articles/openai-offers-two-months-of-free-codex-to-enterprises-switching-from-claude/https://groundy.com/articles/openai-offers-two-months-of-free-codex-to-enterprises-switching-from-claude/OpenAI offered two months of free Codex to Claude switchers. Anthropic lifted weekly quotas 50% through July 13. Teams must weigh switching costs against vendor lock-in.Mon, 18 May 2026 13:01:05 GMTGroundy Editorial2026-06-17T00:00:00.000Zenterprise-aiopenaianthropiccodexclaude-codeai-pricingGroundy Editorialhttps://groundy.com/articles/ab-566-forces-chrome-and-safari-to-ship-opt-out-signals-by-2027-then-shields/https://groundy.com/articles/ab-566-forces-chrome-and-safari-to-ship-opt-out-signals-by-2027-then-shields/AB 566 forces Chrome, Safari, and Edge to ship opt-out signals by January 2027, shields browsers from liability, and leaves Google's 86% GPC failure rate for CPPA to fix.Mon, 18 May 2026 12:47:11 GMTGroundy Editorial2026-05-26T00:00:00.000Zglobal-privacy-controlccpabrowser-privacycalifornia-privacyad-tech-compliancecppa-enforcementGroundy Editorialhttps://groundy.com/articles/praisonai-cve-2026-44338-legacy-flask-api-ships-with-auth-enabled-false-first/https://groundy.com/articles/praisonai-cve-2026-44338-legacy-flask-api-ships-with-auth-enabled-false-first/PraisonAI hard-coded AUTH_ENABLED=False in its legacy Flask server across 2.5.6 to 4.6.33. CVE-Detector/1.0 probed the open /agents endpoint 3h44m after the May 11 advisory.Mon, 18 May 2026 12:27:10 GMTGroundy Editorial2026-06-26T00:00:00.000Zpraisonaiauthentication-bypasscve-2026-44338ai-agent-securityrapid-exploitationflaskvulnerability-disclosureGroundy Editorialhttps://groundy.com/articles/eu-commissions-may-8-article-50-draft-guidelines-pin-ai-disclosure/https://groundy.com/articles/eu-commissions-may-8-article-50-draft-guidelines-pin-ai-disclosure/The EU Commission's May 8 draft guidelines set an 'average consumer' standard for AI disclosure exemptions under Article 50, with a multi-factor vulnerable-group test that.Mon, 18 May 2026 12:10:20 GMTGroundy Editorial2026-06-26T00:00:00.000Zeu-ai-actai-transparencyai-regulationethics-policycompliancechatbot-disclosureGroundy Editorialhttps://groundy.com/articles/nvidia-open-sources-sana-wm-60s-720p-video-from-one-rtx-5090-with-hybrid-linear/https://groundy.com/articles/nvidia-open-sources-sana-wm-60s-720p-video-from-one-rtx-5090-with-hybrid-linear/NVIDIA's SANA-WM generates 60-second 720p video on one RTX 5090, collapsing the H100 barrier and shifting open world models from hardware scarcity to honest evaluation.Mon, 18 May 2026 12:03:30 GMTGroundy Editorial2026-05-18T00:00:00.000Zvideo-generationnvidiaworld-modelslinear-attentiongpu-inferenceopen-sourceGroundy Editorialhttps://groundy.com/articles/white-house-drafts-fda-style-pre-release-vetting-for-frontier-ai-after/https://groundy.com/articles/white-house-drafts-fda-style-pre-release-vetting-for-frontier-ai-after/The White House is studying FDA-style pre-release vetting for frontier AI after Anthropic's Mythos disclosure, but a fast walkback and internal feud have left policy in limbo.Mon, 18 May 2026 11:46:44 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-regulationfrontier-aitrump-administrationanthropicopenaiexecutive-orderfdaGroundy Editorialhttps://groundy.com/articles/kv-cache-offloading-breaks-on-context-intensive-tasks-text2json-exposes/https://groundy.com/articles/kv-cache-offloading-breaks-on-context-intensive-tasks-text2json-exposes/ShadowKV-style KV cache offloading methods pass NIAH and RULER but collapse on synthesis tasks. Text2JSON quantifies the gap; YAKV's per-key selection fixes it.Mon, 18 May 2026 11:21:56 GMTGroundy Editorial2026-06-26T00:00:00.000Zkv-cacheinferencelong-contextllm-benchmarkskv-offloadingquantizationGroundy Editorialhttps://groundy.com/articles/claude-code-v2-1-139-adds-agent-view-one-inbox-for-background-sessions-spacebar/https://groundy.com/articles/claude-code-v2-1-139-adds-agent-view-one-inbox-for-background-sessions-spacebar/Claude Code v2.1.139 adds Agent View, a TUI dashboard for parallel background sessions. Quota scales linearly per agent, and it requires a Pro subscription or higher.Mon, 18 May 2026 11:14:38 GMTGroundy Editorial2026-05-18T00:00:00.000Zagent-viewclaude-codedeveloper-toolsbackground-sessionsagent-orchestrationterminal-uianthropicGroundy Editorialhttps://groundy.com/articles/windsurf-2-2-17-bundles-devin-review-into-every-self-serve-plan/https://groundy.com/articles/windsurf-2-2-17-bundles-devin-review-into-every-self-serve-plan/Windsurf 2.2.17 bundles Devin Review into every self-serve plan, not the full cloud agent. The move compresses two SKUs into one and shifts the pricing comparison against.Mon, 18 May 2026 10:56:03 GMTGroundy Editorial2026-06-10T00:00:00.000Zwindsurfdevincursoridecode-reviewpricingagent-bundlingGroundy Editorialhttps://groundy.com/articles/browseract-open-sources-stealth-browser-engine-with-93-token-reduction-claim/https://groundy.com/articles/browseract-open-sources-stealth-browser-engine-with-93-token-reduction-claim/BrowserAct released browser-act and skill-forge as MIT-licensed open source on May 14, 2026, claiming 93% lower token use and 90% fewer retries versus raw HTML workflows.Mon, 18 May 2026 10:33:00 GMTGroundy Editorial2026-05-18T00:00:00.000Zbrowser-automationopen-sourceai-agentsstealth-browsercomputer-usebrowser-fingerprintingGroundy Editorialhttps://groundy.com/articles/spectral-analysis-of-llm-agent-graphs-predicts-three-failure-modes/https://groundy.com/articles/spectral-analysis-of-llm-agent-graphs-predicts-three-failure-modes/A new paper applies the successor representation to multi-agent LLM graphs, finding condition number perfectly predicts perturbation robustness (r_s=1.0) while spectral.Mon, 18 May 2026 10:25:24 GMTGroundy Editorial2026-05-18T00:00:00.000Zmulti-agentagents-frameworksspectral-analysisllm-topologycrewaiautogengraph-theoryGroundy Editorialhttps://groundy.com/articles/take-it-down-act-hits-may-19-ftcs-48-hour-deepfake-takedown-rule/https://groundy.com/articles/take-it-down-act-hits-may-19-ftcs-48-hour-deepfake-takedown-rule/The Take It Down Act requires platforms to remove nonconsensual imagery within 48 hours starting May 19, replacing Section 230 moderation with a penalized federal mandate.Mon, 18 May 2026 10:06:31 GMTGroundy Editorial2026-05-18T00:00:00.000Zcontent-moderationsection-230deepfakesplatform-liabilityftc-regulationinternet-policynonconsensual-imageryGroundy Editorialhttps://groundy.com/articles/github-copilots-new-multiplier-table-opus-27x-sonnet-9x-codex-6x-for-annual/https://groundy.com/articles/github-copilots-new-multiplier-table-opus-27x-sonnet-9x-codex-6x-for-annual/GitHub's June 1 multiplier table cuts annual Copilot Pro subscribers' effective premium requests by up to 27x for Opus with no rollover, driving Cursor and Windsurf migration.Mon, 18 May 2026 09:49:14 GMTGroundy Editorial2026-06-23T00:00:00.000Zgithub-copilotpricingai-creditsannual-planscursorwindsurfGroundy Editorialhttps://groundy.com/articles/github-copilots-opus-4-7-multiplier-7-5x-to-15x-to-27x-in-60-days/https://groundy.com/articles/github-copilots-opus-4-7-multiplier-7-5x-to-15x-to-27x-in-60-days/GitHub Copilot's Opus 4.7 multiplier tripled from 7.5x to 27x in 60 days. AI Credits billing changes per-turn costs, forcing Pro+ users to decide between Opus and Sonnet 4.6.Mon, 18 May 2026 09:33:34 GMTGroundy Editorial2026-06-17T00:00:00.000Zgithub-copilotopus-47ai-creditspricingagentic-workflowssonnet-46Groundy Editorialhttps://groundy.com/articles/ftc-v-kochava-settlement-data-broker-banned-from-selling-sensitive-location/https://groundy.com/articles/ftc-v-kochava-settlement-data-broker-banned-from-selling-sensitive-location/FTC's Kochava settlement bans selling sensitive location data without affirmative express consent and shifts the consent burden to brokers with mandatory supplier audits.Sun, 17 May 2026 19:23:15 GMTGroundy Editorial2026-06-26T00:00:00.000Zprivacyftcdata-brokerslocation-dataconsentmobile-ad-techsurveillanceGroundy Editorialhttps://groundy.com/articles/microsoft-semantic-kernel-patches-two-rce-paths-eval-in-vector-filter/https://groundy.com/articles/microsoft-semantic-kernel-patches-two-rce-paths-eval-in-vector-filter/Microsoft discloses two CVSS 9.9 Semantic Kernel RCE bugs from tool-design flaws. Trust boundary is each annotated tool method, and all agent frameworks need auditing.Sun, 17 May 2026 17:19:27 GMTGroundy Editorial2026-05-17T00:00:00.000Zsemantic-kernelprompt-injectionrceagent-securitytrust-boundarycveGroundy Editorialhttps://groundy.com/articles/fisker-owners-open-source-the-ocean-ev-can-bus-maps-home-assistant/https://groundy.com/articles/fisker-owners-open-source-the-ocean-ev-can-bus-maps-home-assistant/After Fisker's 2024 bankruptcy, 4,000 owners reverse-engineered the Ocean EV's cloud API, published CAN bus maps, and proved vendor death need not brick a fleet.Sun, 17 May 2026 14:53:28 GMTGroundy Editorial2026-05-17T00:00:00.000Zfisker-oceanopen-source-evcan-bushome-assistantsoftware-defined-vehiclesright-to-repairev-communityGroundy Editorialhttps://groundy.com/articles/ifpvs-adversarial-cognitive-simulation-cuts-multi-agent-operational-cost/https://groundy.com/articles/ifpvs-adversarial-cognitive-simulation-cuts-multi-agent-operational-cost/IFPV pairs a multi-agent planner with a fine-tuned adversarial simulator, cutting operational cost 41.7% in ACTS and challenging agent frameworks to own plan verification.Sun, 17 May 2026 11:02:07 GMTGroundy Editorial2026-05-17T00:00:00.000Zmulti-agentadversarial-simulationagent-frameworkslanggraphplan-verificationllm-planningautogenGroundy Editorialhttps://groundy.com/articles/llm-agent-for-iterative-chart-refinement-exposes-a-logging-gap-in-crewai/https://groundy.com/articles/llm-agent-for-iterative-chart-refinement-exposes-a-logging-gap-in-crewai/An arxiv paper shows iterative chart agents need per-step rationale schemas that CrewAI and AG2 lack, while the token and storage cost of structured traces remains unmeasured.Wed, 29 Apr 2026 21:26:53 GMTGroundy Editorial2026-04-29T00:00:00.000Zagents-frameworksiterative-refinementobservabilitycrewaiautogendata-visualizationllm-agentsGroundy Editorialhttps://groundy.com/articles/citizen-lab-names-three-telcos-as-persistent-entry-points-for-commercial-ss7/https://groundy.com/articles/citizen-lab-names-three-telcos-as-persistent-entry-points-for-commercial-ss7/Citizen Lab names 019Mobile, Tango Networks, and Airtel Jersey as persistent entry points for commercial SS7 surveillance vendors, shifting accountability to named carriers.Wed, 29 Apr 2026 20:42:57 GMTGroundy Editorial2026-04-29T00:00:00.000Zss7surveillancecitizen-labtelecom-securitydiameterghost-mnoregulatory-enforcementGroundy Editorialhttps://groundy.com/articles/pgbackrest-is-no-longer-maintained-postgresql-backup-alternatives-after/https://groundy.com/articles/pgbackrest-is-no-longer-maintained-postgresql-backup-alternatives-after/pgBackRest was archived on April 27, 2026, then revived weeks later by a nine-sponsor coalition. The pgxbackup fork leaves PostgreSQL shops a two-tree backup decision.Wed, 29 Apr 2026 20:15:27 GMTGroundy Editorial2026-06-26T00:00:00.000Zpgbackrestpostgresqlbackupswal-gbarmankubernetesopen-sourceGroundy Editorialhttps://groundy.com/articles/windsurf-cve-2026-30615-is-the-only-zero-click-in-the-april-mcp-rce-wave-html/https://groundy.com/articles/windsurf-cve-2026-30615-is-the-only-zero-click-in-the-april-mcp-rce-wave-html/CISA-ADP scored CVE-2026-30615 CVSS 8.0 HIGH, making Windsurf the sole zero-click IDE in the April MCP RCE wave: attacker HTML silently rewrites mcp.json with no user.Wed, 29 Apr 2026 19:33:05 GMTGroundy Editorial2026-04-29T00:00:00.000Zmcp-securitycve-2026-30615windsurfremote-code-executionai-ide-securityprompt-injectionzero-clickGroundy Editorialhttps://groundy.com/articles/crewai-1-14-2-lands-checkpoint-tui-with-tree-view-fork-support-and-lineage/https://groundy.com/articles/crewai-1-14-2-lands-checkpoint-tui-with-tree-view-fork-support-and-lineage/CrewAI 1.14.2 and 1.14.3 ship a checkpoint TUI with fork support and lineage tracking, making resumability a framework primitive for expensive multi-step agent pipelines.Wed, 29 Apr 2026 18:56:17 GMTGroundy Editorial2026-04-29T00:00:00.000Zcrewaicheckpointingmulti-agentlanggraphagent-orchestrationdev-toolsGroundy Editorialhttps://groundy.com/articles/paperclip-cve-2026-41208-agents-can-mutate-their-own-provisioncommand/https://groundy.com/articles/paperclip-cve-2026-41208-agents-can-mutate-their-own-provisioncommand/Any valid Paperclip Agent API key lets a holder overwrite provisionCommand so the server executes arbitrary shell commands during workspace provisioning without admin access.Wed, 29 Apr 2026 18:23:53 GMTGroundy Editorial2026-04-29T00:00:00.000Zsecuritypaperclipcve-2026-41208agent-orchestrationshell-injectiontrust-boundaryapi-securityGroundy Editorialhttps://groundy.com/articles/spring-ai-1-0-6-patches-five-cves-including-cvss-8-8-sql-injection/https://groundy.com/articles/spring-ai-1-0-6-patches-five-cves-including-cvss-8-8-sql-injection/Spring AI 1.0.6 patches five CVEs including SQL injection and filter-expression escapes across 14+ vector stores, proving that RAG retrieval layers are not sanitized database.Wed, 29 Apr 2026 17:48:25 GMTGroundy Editorial2026-04-29T00:00:00.000Zspring-aicvesql-injectionrag-securityvector-storefilter-expressionpatch-releaseGroundy Editorialhttps://groundy.com/articles/lmdeploy-cve-2026-33626-vision-llm-ssrf-exploited-within-12-hours-of-ghsa/https://groundy.com/articles/lmdeploy-cve-2026-33626-vision-llm-ssrf-exploited-within-12-hours-of-ghsa/CVE-2026-33626 in LMDeploy's vision endpoint was exploited 12.5 hours after GHSA disclosure, with attackers targeting AWS IMDS and Redis via the image-fetch SSRF path.Wed, 29 Apr 2026 17:24:28 GMTGroundy Editorial2026-04-29T00:00:00.000Zssrflmdeployvision-llmcloud-securityinference-securitycve-2026-33626aws-imdsGroundy Editorialhttps://groundy.com/articles/instructlab-cve-2026-6859-hardcoded-trust-remote-code-true-turns-any/https://groundy.com/articles/instructlab-cve-2026-6859-hardcoded-trust-remote-code-true-turns-any/InstructLab CVE-2026-6859 hardcodes trust_remote_code=True in transformers, enabling RCE from any HuggingFace repo. Existing supply-chain scanners cannot detect this vector.Wed, 29 Apr 2026 16:37:52 GMTGroundy Editorial2026-04-29T00:00:00.000Zsecurityinstructlabcve-2026-6859supply-chainhuggingfacetrust-remote-coderceGroundy Editorialhttps://groundy.com/articles/picklescan-1-0-4-patches-a-cvss-10-0-pkgutil-resolve-name-bypass-and-six/https://groundy.com/articles/picklescan-1-0-4-patches-a-cvss-10-0-pkgutil-resolve-name-bypass-and-six/PickleScan 1.0.4 patched three critical bypasses, but the fixes expose a deeper flaw: denylist scanning cannot keep pickle safe. The structural fix is safetensors migration.Wed, 29 Apr 2026 15:59:27 GMTGroundy Editorial2026-06-26T00:00:00.000Zsecuritypicklescansafetensorshugging-facepythonmachine-learningcveGroundy Editorialhttps://groundy.com/articles/pydantic-ai-v1-87-closes-the-langgraph-gap-deferred-tool-calls-opentelemetry/https://groundy.com/articles/pydantic-ai-v1-87-closes-the-langgraph-gap-deferred-tool-calls-opentelemetry/Pydantic AI v1.83-v1.87 added deferred tool calls, OpenTelemetry evaluation, and stateful compaction, closing the gap that previously favored LangGraph.Wed, 29 Apr 2026 15:33:59 GMTGroundy Editorial2026-06-10T00:00:00.000Zpydantic-ailanggraphagent-frameworkspythonopentelemetryhuman-in-the-loopstate-managementGroundy Editorialhttps://groundy.com/articles/mercors-4tb-lapsus-breach-hands-voice-clone-attackers-40-000-pre-verified/https://groundy.com/articles/mercors-4tb-lapsus-breach-hands-voice-clone-attackers-40-000-pre-verified/Mercor's LiteLLM breach exposed interviews with IDs and 2-5 minute voice samples, collapsing the cost of voice-clone phishing by pairing clean audio with verified identities.Wed, 29 Apr 2026 14:56:25 GMTGroundy Editorial2026-06-26T00:00:00.000Zsecurityvoice-cloningsupply-chainbiometric-privacyphishinglitellmGroundy Editorialhttps://groundy.com/articles/google-ignores-californias-global-privacy-control-86-of-the-time-webxrays-7-000/https://groundy.com/articles/google-ignores-californias-global-privacy-control-86-of-the-time-webxrays-7-000/webXray's March 2026 audit found Google ignored California's GPC opt-out in 86% of cases, with Meta at 69% and Microsoft at 50%, exposing systemic CCPA noncompliance.Wed, 29 Apr 2026 14:18:23 GMTGroundy Editorial2026-06-26T00:00:00.000Zprivacygpcccpaad-techcompliancedata-trackingcaliforniaGroundy Editorialhttps://groundy.com/articles/council-mode-cuts-multi-agent-llm-hallucination-35-9-at-4-2x-token-cost/https://groundy.com/articles/council-mode-cuts-multi-agent-llm-hallucination-35-9-at-4-2x-token-cost/Council Mode routes queries through three frontier LLMs and a consensus model, cutting hallucinations 35.9% on HaluEval at 4.2x token cost. Major frameworks lack this pattern.Wed, 29 Apr 2026 13:41:11 GMTGroundy Editorial2026-06-10T00:00:00.000Zmulti-agent-consensusllm-hallucinationcouncil-modecrewaiautogenlanggraphtoken-costGroundy Editorialhttps://groundy.com/articles/claude-code-vs-cursor-vs-copilot-after-the-april-2026-reshuffle-how/https://groundy.com/articles/claude-code-vs-cursor-vs-copilot-after-the-april-2026-reshuffle-how/GitHub's April 20 Copilot changes made tool choice a cost-forecasting exercise in three incompatible billing units, not a UX debate or feature comparison.Wed, 29 Apr 2026 12:25:19 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-coding-toolsclaude-codecursorgithub-copilotdeveloper-toolspricing-modelscost-comparisonGroundy Editorialhttps://groundy.com/articles/california-sb-1119-and-ab-2023-cleared-committee-april-21-companion-chatbots/https://groundy.com/articles/california-sb-1119-and-ab-2023-cleared-committee-april-21-companion-chatbots/California companion-chatbot bills advanced in April 2026, mandating annual AG-filed audits, hard usage caps for minors, and per-child civil liability.Wed, 29 Apr 2026 12:03:04 GMTGroundy Editorial2026-04-29T00:00:00.000Zai-regulationchatbot-safetycalifornia-legislationchild-protectioncompanion-aicompliance-riskGroundy Editorialhttps://groundy.com/articles/langgraph-1-1-10s-toolnode-now-accepts-list-command-toolmessage-how-that-splits/https://groundy.com/articles/langgraph-1-1-10s-toolnode-now-accepts-list-command-toolmessage-how-that-splits/LangGraph 1.1.10 lets tools return both Commands and ToolMessages in one call, which Pydantic AI's plain Python returns cannot match. The gap adds friction for hybrid stacks.Wed, 29 Apr 2026 11:24:27 GMTGroundy Editorial2026-04-29T00:00:00.000Zlanggraphpydantic-aiagent-frameworkstool-nodegraph-orchestrationstate-commandsai-engineeringGroundy Editorialhttps://groundy.com/articles/salesforce-tdx-2026-headless-360-ships-60-mcp-tools-and-agentforce-vibes/https://groundy.com/articles/salesforce-tdx-2026-headless-360-ships-60-mcp-tools-and-agentforce-vibes/Salesforce TDX 2026 shipped 60+ MCP tools and a Claude-default IDE, collapsing wrapper value for LangGraph, CrewAI, and AutoGen while shifting to cross-MCP routing.Wed, 29 Apr 2026 10:16:23 GMTGroundy Editorial2026-05-18T00:00:00.000Zsalesforcemcp-toolsagentforcelanggraphcrewaiautogenagentic-orchestrationGroundy Editorialhttps://groundy.com/articles/crawshaws-i-am-building-a-cloud-what-a-tailscale-co-founders-solo-stack-implies/https://groundy.com/articles/crawshaws-i-am-building-a-cloud-what-a-tailscale-co-founders-solo-stack-implies/David Crawshaw's exe.dev launched with $35M, giving platform teams a concrete alternative to the Kubernetes default that forces TCO justification for cloud-native overhead.Wed, 29 Apr 2026 09:30:40 GMTGroundy Editorial2026-06-26T00:00:00.000Zinfrastructurekubernetescloud-costsbare-metalplatform-engineeringtailscaleexe-devGroundy Editorialhttps://groundy.com/articles/vercels-april-2026-database-leak-pivoted-from-lumma-stealer-at-context-ai-via/https://groundy.com/articles/vercels-april-2026-database-leak-pivoted-from-lumma-stealer-at-context-ai-via/Vercel's April 2026 breach began with Lumma Stealer at Context AI and pivoted through a Chrome extension OAuth token. Browser extensions are an unaudited supply-chain vector.Tue, 28 Apr 2026 20:50:59 GMTGroundy Editorial2026-04-29T00:00:00.000Zvercel-breachsupply-chain-attackchrome-extensionoauth-securitylumma-stealerbrowser-securityGroundy Editorialhttps://groundy.com/articles/github-copilot-replaces-premium-request-units-with-token-metered-ai-credits/https://groundy.com/articles/github-copilot-replaces-premium-request-units-with-token-metered-ai-credits/GitHub Copilot replaces Premium Request Units with token-metered AI Credits on June 1. Teams must reprice agent workflows as token billing ends flat-rate subsidies.Tue, 28 Apr 2026 19:31:55 GMTGroundy Editorial2026-06-22T00:00:00.000Zgithub-copilotai-creditsusage-based-billingtoken-metereddeveloper-toolspricingGroundy Editorialhttps://groundy.com/articles/free-claude-code-routes-claude-code-through-nvidia-nim-and-local-models-after/https://groundy.com/articles/free-claude-code-routes-claude-code-through-nvidia-nim-and-local-models-after/free-claude-code reroutes Claude Code API calls to NVIDIA NIM, OpenRouter, or local backends. The proxy cuts API costs but cannot normalize capability across providers.Tue, 28 Apr 2026 18:21:13 GMTGroundy Editorial2026-07-06T00:00:00.000Zopen-sourceapi-proxynvidia-nimclaude-codelocal-inferencemodel-routingopenrouterGroundy Editorialhttps://groundy.com/articles/microsoft-and-openai-end-their-exclusive-revenue-sharing-deal-what-it-means/https://groundy.com/articles/microsoft-and-openai-end-their-exclusive-revenue-sharing-deal-what-it-means/Microsoft and OpenAI ended their exclusive compute deal on April 27. Azure loses model exclusivity, so enterprise buyers on Azure for OpenAI access must reassess procurement.Tue, 28 Apr 2026 16:58:37 GMTGroundy Editorial2026-06-26T00:00:00.000Zmicrosoft-openai-partnershipazurecloud-computingenterprise-procurementopenaimulti-cloudai-infrastructureGroundy Editorialhttps://groundy.com/articles/anthropic-ends-flat-fee-enterprise-claude-above-150-seats-and-forces-per-token/https://groundy.com/articles/anthropic-ends-flat-fee-enterprise-claude-above-150-seats-and-forces-per-token/Anthropic ends bundled-token enterprise plans in March 2026 for a $20 base plus metered API usage. FinOps teams must model costs around token variance, not fixed seat math.Tue, 28 Apr 2026 15:08:42 GMTGroundy Editorial2026-07-07T00:00:00.000Zanthropicenterprise-aiai-pricingfinopstoken-billingclaude-codeusage-based-pricingGroundy Editorialhttps://groundy.com/articles/americas-150-gw-geothermal-estimate-reprices-ai-data-center-power-procurement/https://groundy.com/articles/americas-150-gw-geothermal-estimate-reprices-ai-data-center-power-procurement/Geothermal estimates up to 150 GW give AI data centers a third firm-clean power option beyond nuclear restarts, shifting the bottleneck to subsurface leases.Tue, 28 Apr 2026 14:21:47 GMTGroundy Editorial2026-04-29T00:00:00.000Zgeothermal-energyai-data-centerspower-procurementnuclear-energyenhanced-geothermalenergy-infrastructuresite-selectionGroundy Editorialhttps://groundy.com/articles/bitwarden-cli-compromise-extends-the-checkmarx-supply-chain-campaign/https://groundy.com/articles/bitwarden-cli-compromise-extends-the-checkmarx-supply-chain-campaign/A trojanized @bitwarden/cli release spent 93 minutes on npm April 22. The Checkmarx-themed payload harvested credentials via preinstall hook, exposing vault session tokens.Tue, 28 Apr 2026 11:30:37 GMTGroundy Editorial2026-06-26T00:00:00.000Zsupply-chainbitwardennpm-malwarecredential-theftdeveloper-securityci-cdcheckmarxGroundy Editorialhttps://groundy.com/articles/there-will-be-a-scientific-theory-of-deep-learning-what-arxiv-2604-21691-argues/https://groundy.com/articles/there-will-be-a-scientific-theory-of-deep-learning-what-arxiv-2604-21691-argues/Fourteen theorists argue fragmented deep-learning theory is converging into 'learning mechanics,' but concede scaling exponents and nonlinear stability remain open.Tue, 28 Apr 2026 10:39:57 GMTGroundy Editorial2026-04-29T00:00:00.000Zdeep-learningscaling-lawstraining-dynamicsneural-tangent-kerneledge-of-stabilitygeneralizationGroundy Editorialhttps://groundy.com/articles/github-cli-v2910-turns-on-default-telemetry-what-gh-collects-and-how-to-opt-out/https://groundy.com/articles/github-cli-v2910-turns-on-default-telemetry-what-gh-collects-and-how-to-opt-out/GitHub CLI v2.91.0 enables pseudonymous telemetry by default, collecting command paths, flags, CI context, and device IDs on 1% of invocations. Teams running gh inside Claude.Fri, 24 Apr 2026 20:28:33 GMTGroundy Editorial2026-04-24T00:00:00.000Zgithub-clitelemetrydeveloper-toolsci-cdprivacyai-agentsGroundy Editorialhttps://groundy.com/articles/github-copilot-drops-opus-from-pro-and-pauses-signups-the-forced-migration/https://groundy.com/articles/github-copilot-drops-opus-from-pro-and-pauses-signups-the-forced-migration/GitHub removed all Opus models from Copilot Pro on April 20 and flagged older versions for Pro+ removal. Opus 4.8 is the top Opus-tier model available through Copilot Pro+.Fri, 24 Apr 2026 19:01:53 GMTGroundy Editorial2026-06-17T00:00:00.000Zgithub-copilotclaude-opusdeveloper-toolsllm-pricingagentic-workflowsanthropicGroundy Editorialhttps://groundy.com/articles/cloudflare-agents-week-moved-sandbox-execution-private-networking-and-memory/https://groundy.com/articles/cloudflare-agents-week-moved-sandbox-execution-private-networking-and-memory/Cloudflare shipped four production primitives in April 2026, Sandboxes GA, Mesh, Dynamic Workers, and Agent Memory, replacing infrastructure CrewAI, LangGraph, and AutoGen.Fri, 24 Apr 2026 16:20:24 GMTGroundy Editorial2026-05-26T00:00:00.000Zcloudflareagents-frameworksai-infrastructuresandboxesmulti-agentGroundy Editorialhttps://groundy.com/articles/flowises-cve-2026-41264-llm-written-import-becomes-unauthenticated-rce/https://groundy.com/articles/flowises-cve-2026-41264-llm-written-import-becomes-unauthenticated-rce/CVE-2026-41264 (CVSS 9.8) shows how Flowise's CSV Agent regex allowlist fails when the LLM writes the code: aliasing os as pandas bypasses the filter for unauthenticated RCE.Fri, 24 Apr 2026 15:03:03 GMTGroundy Editorial2026-06-26T00:00:00.000Zprompt-injectionagent-securityrceflowisellm-code-executionsandbox-bypassGroundy Editorialhttps://groundy.com/articles/inside-rowboats-knowledge-graph-why-an-obsidian-compatible-vault-sidesteps/https://groundy.com/articles/inside-rowboats-knowledge-graph-why-an-obsidian-compatible-vault-sidesteps/Rowboat v0.3.1 replaces the vector DB tier with a plain Markdown knowledge graph, cutting infra overhead for local-first agents but tying retrieval quality to link density.Fri, 24 Apr 2026 13:29:50 GMTGroundy Editorial2026-04-24T00:00:00.000Zknowledge-graphvector-databaselocal-firstobsidianai-memorymcpGroundy Editorialhttps://groundy.com/articles/uccl-zip-brings-lossless-compression-to-nccl-collectives-475-faster-rl-weight/https://groundy.com/articles/uccl-zip-brings-lossless-compression-to-nccl-collectives-475-faster-rl-weight/UCCL-Zip fuses lossless compression into NCCL and GPU P2P transfers, cutting RL weight sync by 47.5% and vLLM latency by 10% with no API changes and bit-identical outputs.Fri, 24 Apr 2026 12:07:10 GMTGroundy Editorial2026-05-26T00:00:00.000Znccllossless-compressiongpu-communicationvllmrl-trainingprefill-decodedistributed-inferenceGroundy Editorialhttps://groundy.com/articles/citizen-labs-bad-connection-report-names-three-telecom-entry-points-including/https://groundy.com/articles/citizen-labs-bad-connection-report-names-three-telecom-entry-points-including/Citizen Lab names 019Mobile and two carriers as surveillance transit points and shows roaming-forced SS7 fallback undermines Diameter protections even on upgraded networks.Fri, 24 Apr 2026 10:51:28 GMTGroundy Editorial2026-06-26T00:00:00.000Ztelecom-securityss7-diametersurveillanceroaming-securitygt-leasingsignaling-firewallcitizen-labGroundy Editorialhttps://groundy.com/articles/diversity-collapse-in-multi-agent-llm-systems-structural-coupling-breaks-open/https://groundy.com/articles/diversity-collapse-in-multi-agent-llm-systems-structural-coupling-breaks-open/An ACL 2026 Findings paper finds multi-agent LLM brainstorming collapses because agents share models, prompts, and context, not because topologies are too dense.Thu, 23 Apr 2026 20:31:11 GMTGroundy Editorial2026-06-10T00:00:00.000Zmulti-agentdiversity-collapsestructural-couplingagent-frameworkscrewaiautogenlanggraphGroundy Editorialhttps://groundy.com/articles/litert-lm-v0101-ships-gemma-4-mtp-heads-that-llamacpp-cant-access/https://groundy.com/articles/litert-lm-v0101-ships-gemma-4-mtp-heads-that-llamacpp-cant-access/LiteRT-LM v0.10.1 ships Gemma 4 with Qualcomm NPU acceleration, but Google stripped MTP heads from public weights, locking peak Gemma 4 throughput to its own runtime.Thu, 23 Apr 2026 19:43:48 GMTGroundy Editorial2026-07-04T00:00:00.000Zlitert-lmedge-inferencegemmallama-cppmulti-token-predictionqualcomm-npuon-device-aiGroundy Editorialhttps://groundy.com/articles/hugging-faces-spring-2026-state-of-open-source-report-china-hits-41-of/https://groundy.com/articles/hugging-faces-spring-2026-state-of-open-source-report-china-hits-41-of/Chinese models hit 41% of Hugging Face downloads, overtaking the US, while independents hit 39%. Top 200 models capture half of all downloads, forcing Western procurement.Thu, 23 Apr 2026 18:08:10 GMTGroundy Editorial2026-06-19T00:00:00.000Zhugging-faceopen-sourcechina-aimodel-ecosystemprocurementzhipuqwenGroundy Editorialhttps://groundy.com/articles/qwen36-27bs-dense-architecture-challenges-the-moe-only-playbook-for-flagship/https://groundy.com/articles/qwen36-27bs-dense-architecture-challenges-the-moe-only-playbook-for-flagship/Alibaba's dense Qwen3.6-27B outperforms its MoE sibling on coding benchmarks, trading predictable inference latency for a larger memory footprint than sparse alternatives.Thu, 23 Apr 2026 16:05:25 GMTGroundy Editorial2026-06-10T00:00:00.000Zqwendense-modelsmoeinferencecoding-modelsmodel-architecturellm-deploymentGroundy Editorialhttps://groundy.com/articles/sglangs-cve-2026-5760-turns-a-gguf-download-into-rce-and-shifts-the-trust/https://groundy.com/articles/sglangs-cve-2026-5760-turns-a-gguf-download-into-rce-and-shifts-the-trust/CVE-2026-5760 lets poisoned GGUF files trigger Jinja2 SSTI through SGLang's unsandboxed template rendering, forcing teams to treat hub downloads as executable code.Thu, 23 Apr 2026 14:48:56 GMTGroundy Editorial2026-06-26T00:00:00.000Zsglangcve-2026-5760jinja2-sstigguf-securitymodel-hub-trustinference-securityremote-code-executionGroundy Editorialhttps://groundy.com/articles/neural-computers-from-metaauto-signal-that-video-models-can-replace-shell/https://groundy.com/articles/neural-computers-from-metaauto-signal-that-video-models-can-replace-shell/Neural Computers replace the interpreter with learned pixel I/O, but the paper shows these agents fail at symbolic state and multi-step arithmetic.Thu, 23 Apr 2026 13:39:23 GMTGroundy Editorial2026-05-26T00:00:00.000Zneural-computersmetaautovideo-modelsopen-sourcesymbolic-reasoningagent-architecturecomputer-useGroundy Editorialhttps://groundy.com/articles/marchapril-mcp-cves-expose-the-local-host-trust-model-in-ai-agent-frameworks/https://groundy.com/articles/marchapril-mcp-cves-expose-the-local-host-trust-model-in-ai-agent-frameworks/Three CVEs scoring up to 9.8 reveal a structural flaw: MCP's local-host trust model lacks authentication primitives for networked multi-tenant deployments.Thu, 23 Apr 2026 12:23:30 GMTGroundy Editorial2026-04-24T00:00:00.000Zmcp-securitycveauthenticationai-agentsprotocol-designvulnerabilitysupply-chainGroundy Editorialhttps://groundy.com/articles/ingress-nginx-is-dead-not-deprecated-the-final-cve-patches-shipped-but-platform/https://groundy.com/articles/ingress-nginx-is-dead-not-deprecated-the-final-cve-patches-shipped-but-platform/ingress-nginx was retired March 24, 2026. CVE-2026-4342 patches shipped March 19, but no future fixes are coming. How platform teams should pick a migration path.Thu, 23 Apr 2026 11:41:23 GMTGroundy Editorial2026-05-26T00:00:00.000Zkubernetesnetworkingingressgateway-apisecuritymigrationGroundy Editorialhttps://groundy.com/articles/lace-forces-vllm-and-sglang-to-rethink-how-parallel-reasoning-threads-run/https://groundy.com/articles/lace-forces-vllm-and-sglang-to-rethink-how-parallel-reasoning-threads-run/LACE lets parallel reasoning threads share state mid-inference, yielding 3-7 point accuracy gains but forcing vLLM and SGLang to abandon independent-sequence batching.Thu, 23 Apr 2026 10:24:06 GMTGroundy Editorial2026-04-23T00:00:00.000Zinferencevllmsglanglattice-attentionparallel-reasoningllm-schedulingbatchingGroundy Editorialhttps://groundy.com/articles/ml-interns-32-gpqa-gain-on-a-single-h100-exposes-the-assumption-that-post/https://groundy.com/articles/ml-interns-32-gpqa-gain-on-a-single-h100-exposes-the-assumption-that-post/ml-intern hit 32% on GPQA in under 10 hours, beating Claude Code's 22.99% on the same task, but a 51% instruction-tuned ceiling marks what the autonomous loop cannot close.Wed, 22 Apr 2026 22:31:45 GMTGroundy Editorial2026-06-10T00:00:00.000Zpost-trainingautonomous-agentsbenchmarkssmolagentsgpqagrporeward-hackingGroundy Editorialhttps://groundy.com/articles/eus-2027-replaceable-battery-mandate-what-it-means-for-phone-buyers-and/https://groundy.com/articles/eus-2027-replaceable-battery-mandate-what-it-means-for-phone-buyers-and/The EU's 2027 battery mandate is confirmed. Here's what 'user-replaceable' legally means, which phones comply now, and how to buy smart before the rules change.Tue, 21 Apr 2026 16:00:00 GMTGroundy Editorial2026-07-03T00:00:00.000Zeu-regulationright-to-repairconsumer-electronicssustainabilitybatteriesGroundy Editorialhttps://groundy.com/articles/acp-registry-is-live-zed-and-jetbrains-just-did-for-ai-agents-what-lsp-did/https://groundy.com/articles/acp-registry-is-live-zed-and-jetbrains-just-did-for-ai-agents-what-lsp-did/The ACP Agent Registry lets developers install AI coding agents once across JetBrains and Zed. Here's what the migration path looks like and whether to commit.Mon, 20 Apr 2026 18:49:27 GMTGroundy Editorial2026-06-26T00:00:00.000Zzedjetbrainsacpai-agentsopen-standardsideGroundy Editorialhttps://groundy.com/articles/atlassian-turned-on-ai-training-data-collection-by-default-heres-what-to-disable/https://groundy.com/articles/atlassian-turned-on-ai-training-data-collection-by-default-heres-what-to-disable/Atlassian's data contribution policy sends Jira and Confluence content to AI training by default. Here's the exact settings path to opt out before August 17.Mon, 20 Apr 2026 15:43:48 GMTGroundy Editorial2026-06-17T00:00:00.000Zdata-privacyenterprise-aiatlassianai-training-datasaasGroundy Editorialhttps://groundy.com/articles/github-clis-gh-skill-command-one-standard-to-rule-claude-code-copilot-cursor/https://groundy.com/articles/github-clis-gh-skill-command-one-standard-to-rule-claude-code-copilot-cursor/GitHub shipped `gh skill` in public preview on April 16, 2026. Here's how the command works, what the open Agent Skills spec promises, and why the ecosystem is already compromised.Mon, 20 Apr 2026 12:37:07 GMTGroundy Editorial2026-06-17T00:00:00.000Zgithubcliagent-skillsdeveloper-toolsai-codingGroundy Editorialhttps://groundy.com/articles/openrag-open-source-rag-platform-challenging/https://groundy.com/articles/openrag-open-source-rag-platform-challenging/OpenRAG combines Langflow, OpenSearch, and Docling into a single deployable RAG platform. Here's how it compares to managed services like Pinecone.Fri, 27 Mar 2026 19:24:22 GMTGroundy Editorial2026-06-26T00:00:00.000Zai-infrastructureragopen-sourcevector-databaseself-hostingenterprise-searchGroundy Editorialhttps://groundy.com/articles/javascript-s-date-problem-finally-fixed-temporal-api-after/https://groundy.com/articles/javascript-s-date-problem-finally-fixed-temporal-api-after/The Temporal API reached Stage 4 and is shipping in browsers. Here's what it fixes about JavaScript's notoriously broken Date object and how to use it.Fri, 27 Mar 2026 16:17:24 GMTGroundy Editorial2026-06-20T00:00:00.000Zdeveloper-toolsjavascriptweb-standardsGroundy Editorialhttps://groundy.com/articles/insforge-backend-framework-built-specifically-agentic/https://groundy.com/articles/insforge-backend-framework-built-specifically-agentic/InsForge is a backend-as-a-service platform purpose-built for AI coding agents, delivering 1.6x faster task completion and 2.4x fewer tokens than Supabase.Fri, 27 Mar 2026 14:31:51 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-engineeringbackendframeworksGroundy Editorialhttps://groundy.com/articles/ai-grief-split-when-people-build-emotional-bonds-language/https://groundy.com/articles/ai-grief-split-when-people-build-emotional-bonds-language/People form real emotional bonds with AI companions. When models update or shut down, users experience genuine grief, a psychological and ethical crisis point.Fri, 27 Mar 2026 11:18:19 GMTGroundy Editorial2026-06-20T00:00:00.000Zai-ethicspsychologyhuman-aiGroundy Editorialhttps://groundy.com/articles/mlx-vs-llamacpp-on-apple-silicon-which-runtime-to-use-for-local-llm-inference/https://groundy.com/articles/mlx-vs-llamacpp-on-apple-silicon-which-runtime-to-use-for-local-llm-inference/MLX delivers 20-87% faster generation on Apple Silicon for models under 14B parameters. llama.cpp wins for cross-platform use and long contexts.Tue, 24 Mar 2026 16:48:05 GMTGroundy Editorial2026-06-19T00:00:00.000Zmlxllama-cppapple-siliconon-device-inferencemacoslocal-llmGroundy Editorialhttps://groundy.com/articles/prefill-decode-disaggregation-the-architecture-shift-redefining-llm-serving-at-scale/https://groundy.com/articles/prefill-decode-disaggregation-the-architecture-shift-redefining-llm-serving-at-scale/Prefill-decode disaggregation separates compute-bound prefill from memory-bound decode onto dedicated hardware, eliminating phase interference.Tue, 24 Mar 2026 16:04:14 GMTGroundy Editorial2026-07-12T00:00:00.000Zllm-servingprefilldecode-disaggregationinference-infrastructuremooncakeGroundy Editorialhttps://groundy.com/articles/swe-bench-verified-explained-what-the-coding-agent-leaderboard-actually-measures-and-what-it-misses/https://groundy.com/articles/swe-bench-verified-explained-what-the-coding-agent-leaderboard-actually-measures-and-what-it-misses/SWE-bench Verified tests AI agents on 500 real GitHub bug fixes. Learn what 'resolved 49%' means, how scoring works, and the benchmark's critical blind spots.Tue, 24 Mar 2026 15:05:13 GMTGroundy Editorial2026-06-10T00:00:00.000Zswe-benchcoding-agentsbenchmarksai-codingclaudeGroundy Editorialhttps://groundy.com/articles/the-chinese-ai-model-ecosystem-deepseek-qwen-kimi-doubao-and-ernie-compared/https://groundy.com/articles/the-chinese-ai-model-ecosystem-deepseek-qwen-kimi-doubao-and-ernie-compared/DeepSeek isn't China's only frontier AI. Compare DeepSeek, Qwen, Kimi, Doubao, and Ernie on benchmarks, licensing, API access, and use-case fit.Tue, 24 Mar 2026 14:57:11 GMTGroundy Editorial2026-06-19T00:00:00.000Zdeepseekqwenkimidoubaoerniechinese-aialibababaidubytedanceGroundy Editorialhttps://groundy.com/articles/how-to-run-claude-code-as-a-github-actions-agent-for-automated-pr-fixes/https://groundy.com/articles/how-to-run-claude-code-as-a-github-actions-agent-for-automated-pr-fixes/How to wire Claude Code into GitHub Actions for automated PR fixes, CI failure remediation, and code review, with cost controls, model options, and security guardrails.Tue, 24 Mar 2026 14:36:19 GMTGroundy Editorial2026-06-19T00:00:00.000Zclaude-codegithub-actionsci-cdcoding-agentsautomationGroundy Editorialhttps://groundy.com/articles/running-deepseek-r1-locally-hardware-requirements-quantization-and-real-throughput/https://groundy.com/articles/running-deepseek-r1-locally-hardware-requirements-quantization-and-real-throughput/What hardware actually runs DeepSeek R1 at useful speeds? Specific token/s benchmarks across GPU configs, quantization options, and the honest tradeoffs.Tue, 24 Mar 2026 14:23:24 GMTGroundy Editorial2026-06-20T00:00:00.000Zdeepseeklocal-inferencequantizationhardwareollamaGroundy Editorialhttps://groundy.com/articles/jetbrains-new-language-lets-you-talk-llms-specs-not/https://groundy.com/articles/jetbrains-new-language-lets-you-talk-llms-specs-not/CodeSpeak compiles structured English into production code via LLMs. Kotlin creator Andrey Breslav's bet: ad hoc prompting is too ambiguous for serious software development.Sun, 15 Mar 2026 20:17:23 GMTGroundy Editorial2026-06-29T00:00:00.000Zprogrammingai-toolsdeveloper-experiencekotlinllm-code-generationGroundy Editorialhttps://groundy.com/articles/fish-speech-open-source-tts-model-that-s-threatening/https://groundy.com/articles/fish-speech-open-source-tts-model-that-s-threatening/Fish Audio's open-source S2 TTS hit SOTA in March 2026 with sub-100ms latency and 80+ languages, challenging ElevenLabs' commercial pricing and exposing licensing gaps.Sun, 15 Mar 2026 17:01:51 GMTGroundy Editorial2026-06-17T00:00:00.000Zai-modelsopen-sourceaudio-aielevenlabsvoice-cloningfish-audioGroundy Editorialhttps://groundy.com/articles/google-litert-running-llms-your-phone-without/https://groundy.com/articles/google-litert-running-llms-your-phone-without/Google's LiteRT (formerly TensorFlow Lite) powers on-device GenAI on Android, Chrome, and Pixel. What developers need to know about private, offline inference.Sun, 15 Mar 2026 16:00:00 GMTGroundy Editorial2026-06-29T00:00:00.000Zai-infrastructuremobileedge-aigooglelitertgemmaon-device-aiGroundy Editorialhttps://groundy.com/articles/alibaba-s-page-agent-control-any-website-natural/https://groundy.com/articles/alibaba-s-page-agent-control-any-website-natural/Alibaba's page-agent is a JavaScript library that embeds an AI agent directly into web pages for natural language DOM control. No extensions, Python, or headless Chrome needed.Sun, 15 Mar 2026 15:59:48 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-toolsbrowser-automationagentsalibabaopen-sourcejavascriptllmGroundy Editorialhttps://groundy.com/articles/ai-diagnostics-2026-where-machines-now-outperform/https://groundy.com/articles/ai-diagnostics-2026-where-machines-now-outperform/AI diagnostic tools outperform radiologists in specific imaging tasks, yet fewer than 10% of U.S. hospitals deploy them clinically. The evidence, gaps, and barriers.Sun, 15 Mar 2026 13:26:10 GMTGroundy Editorial2026-06-09T00:00:00.000Zhealthcareai-modelsmedicalradiologydiagnosticsdigital-pathologyGroundy Editorialhttps://groundy.com/articles/ai-agents-that-actually-learn-architecture-behind-hindsight/https://groundy.com/articles/ai-agents-that-actually-learn-architecture-behind-hindsight/Hindsight by vectorize-io is an open-source agent memory system that replaces stateless retrieval with structured, time-aware memory networks, achieving 91.4% on LongMemEval and showing what genuine agent learning looks like at the architecture level.Sun, 15 Mar 2026 10:56:12 GMTGroundy Editorial2026-06-20T00:00:00.000Zai-engineeringagentsmemoryGroundy Editorialhttps://groundy.com/articles/github-copilot-vs-cursor-vs-claude-code-2026-ai-coding/https://groundy.com/articles/github-copilot-vs-cursor-vs-claude-code-2026-ai-coding/GitHub Copilot owns enterprise, Cursor owns developer wallets at $2B ARR, and Claude Code leads the benchmarks. Which fits your workflow depends on what you build.Sat, 14 Mar 2026 16:29:11 GMTGroundy Editorial2026-07-04T00:00:00.000Zai-toolsdeveloper-toolscoding-assistantsgithub-copilotcursorclaude-codeGroundy Editorialhttps://groundy.com/articles/detecting-ai-content-2026-arms-race-nobody/https://groundy.com/articles/detecting-ai-content-2026-arms-race-nobody/AI detectors claim 99% accuracy but fail in real-world conditions, flagging innocent students. Here's why the arms race has no winner, and what educators should do instead.Sat, 14 Mar 2026 12:44:45 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-safetycontenteducationacademic-integritybiaswatermarkingGroundy Editorialhttps://groundy.com/articles/microsoft-s-bitnet-how-1-bit-llms-could-make-gpu-farms/https://groundy.com/articles/microsoft-s-bitnet-how-1-bit-llms-could-make-gpu-farms/Microsoft's BitNet runs ternary-weight LLMs on ordinary CPUs, with up to 6x faster inference and 82% lower energy than full-precision baselines.Fri, 13 Mar 2026 17:06:56 GMTGroundy Editorial2026-06-26T00:00:00.000Zai-infrastructuremodelshardwarequantizationlocal-llmsedge-aiGroundy Editorialhttps://groundy.com/articles/mckinsey-ai-platform-hacked/https://groundy.com/articles/mckinsey-ai-platform-hacked/CodeWall's autonomous agent breached McKinsey's Lilli platform in two hours via SQL injection, exposing 46.5M messages and writable system prompts through a decades-old vulnerability.Fri, 13 Mar 2026 14:13:59 GMTGroundy Editorial2026-05-24T00:00:00.000Zsecurityenterprise-aivulnerabilitysql-injectionai-securityGroundy Editorialhttps://groundy.com/articles/webassembly-ai-running-models/https://groundy.com/articles/webassembly-ai-running-models/How WebAssembly, WebGPU, and frameworks like Transformers.js and WebLLM run AI models in the browser: the real performance trade-offs and when to use them.Sat, 28 Feb 2026 18:18:13 GMTGroundy Editorial2026-06-26T00:00:00.000Zwebassemblybrowser-aiwebgputransformers-jsonnxlocal-aiGroundy Editorialhttps://groundy.com/articles/superpowers-agentic-framework-replacing-your-dev/https://groundy.com/articles/superpowers-agentic-framework-replacing-your-dev/Superpowers is an open-source agentic framework by Jesse Vincent that enforces structured development workflows on AI coding agents, turning reactive assistants into disciplined engineers.Sat, 28 Feb 2026 14:21:18 GMTGroundy Editorial2026-06-19T00:00:00.000Zai-agentsframeworksclaude-codedeveloper-toolstest-driven-developmentopen-sourceGroundy Editorialhttps://groundy.com/articles/synthetic-data-is-eating-ai-training/https://groundy.com/articles/synthetic-data-is-eating-ai-training/The supply of high-quality human text for AI training is running out. Synthetic data fills the gap, but model collapse and provenance drift set the limits.Fri, 27 Feb 2026 20:38:49 GMTGroundy Editorial2026-06-26T00:00:00.000Zsynthetic-datamodel-collapsetraining-datamachine-learningllm-trainingdata-scalingGroundy Editorialhttps://groundy.com/articles/rust-quietly-replacing-python-ai/https://groundy.com/articles/rust-quietly-replacing-python-ai/Rust is taking over the performance-critical layers of AI infrastructure, inference engines, tokenizers, data pipelines, while Python retains its role in research and orchestration. Here's what's actually changing and why it matters for practitioners.Fri, 27 Feb 2026 19:56:07 GMTGroundy Editorial2026-06-20T00:00:00.000Zrustpythonai-infrastructureGroundy Editorialhttps://groundy.com/articles/openai-s-profit-pivot-what-it-means-future/https://groundy.com/articles/openai-s-profit-pivot-what-it-means-future/OpenAI's October 2025 conversion to a public benefit corporation scrapped the 100x profit cap and dropped 'safely' from its mission. What the nonprofit still controls.Fri, 27 Feb 2026 18:32:05 GMTGroundy Editorial2026-06-26T00:00:00.000Zai-industryopenaigovernancebusinessai-safetysoftbankGroundy Editorialhttps://groundy.com/articles/how-ai-agents-remember-memory-architectures-that/https://groundy.com/articles/how-ai-agents-remember-memory-architectures-that/AI agents use four memory tiers across context windows, vector DBs, knowledge graphs, and model weights. Architecture choice determines session coherence or full reset.Fri, 27 Feb 2026 17:45:00 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-agentsmemorycontext-windowsllm-architectureagents-frameworksGroundy Editorialhttps://groundy.com/articles/google-s-timesfm-foundation-model-time/https://groundy.com/articles/google-s-timesfm-foundation-model-time/TimesFM is Google's decoder-only transformer for zero-shot time-series forecasting, pretrained on ~100 billion real-world points across domains without retraining.Fri, 27 Feb 2026 16:43:07 GMTGroundy Editorial2026-07-05T00:00:00.000Zmachine-learningforecastingtime-seriesfoundation-modelsgoogle-researchzero-shotquantile-forecastingGroundy Editorialhttps://groundy.com/articles/gemini-2-0-pro-s-2-million-token-context-what-can-you/https://groundy.com/articles/gemini-2-0-pro-s-2-million-token-context-what-can-you/Gemini 2.0 Pro's 2 million token context window: what works, what degrades past 1 million tokens, and where the long-context landscape stands as of mid-2026.Fri, 27 Feb 2026 15:24:28 GMTGroundy Editorial2026-06-23T00:00:00.000Zai-modelsgooglegemininlpcontext-windowlong-contextGroundy Editorialhttps://groundy.com/articles/cursor-s-meteoric-rise-inside-ai-editor-hitting-300m/https://groundy.com/articles/cursor-s-meteoric-rise-inside-ai-editor-hitting-300m/Cursor hit $300M ARR in April 2025 by forking VS Code and baking AI into the editor's core. By June 2026 it was at $4B annualized and agreed to a $60B SpaceX acquisition. Here's how it happened and what it signals.Fri, 27 Feb 2026 14:15:59 GMTGroundy Editorial2026-06-19T00:00:00.000Zai-industrycursorstartupsdeveloper-toolsenterprise-softwareventure-capitalGroundy Editorialhttps://groundy.com/articles/stargate-inside-openai-s-100b-plan-build-ai/https://groundy.com/articles/stargate-inside-openai-s-100b-plan-build-ai/OpenAI's Stargate is a $500B joint venture to build U.S. AI data centers. Here's what's being built, who's paying, and what it means for compute markets.Fri, 27 Feb 2026 13:04:33 GMTGroundy Editorial2026-06-26T00:00:00.000Zai-industryinfrastructureopenaidata-centersenergyoraclesoftbankGroundy Editorialhttps://groundy.com/articles/deepseek-v3-r1-how-chinese-engineers-matched-gpt-4-6/https://groundy.com/articles/deepseek-v3-r1-how-chinese-engineers-matched-gpt-4-6/DeepSeek's V3 and R1 models match GPT-4-class performance using a fraction of the compute through architectural innovations in Mixture of Experts, attention compression, and reinforcement learning, demonstrating that training efficiency may matter more than raw hardware scale.Fri, 27 Feb 2026 12:29:12 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-modelsdeepseektrainingefficiencychinaGroundy Editorialhttps://groundy.com/articles/claude-s-web-search-changes-everything-ai/https://groundy.com/articles/claude-s-web-search-changes-everything-ai/Claude's web search delivers real-time retrieval inside the reasoning loop with mandatory citations, domain filtering, and dynamic HTML processing that cuts token use by 24%.Fri, 27 Feb 2026 10:58:55 GMTGroundy Editorial2026-06-25T00:00:00.000Zai-modelsanthropicsearchresearchweb-searchapireal-timeGroundy Editorialhttps://groundy.com/articles/million-token-context-window-what-can-you-actually/https://groundy.com/articles/million-token-context-window-what-can-you-actually/Million-token context windows let you load entire codebases in one pass, but models lose coherence before their limit. Here is what benchmarks and failure modes reveal.Fri, 27 Feb 2026 09:59:28 GMTGroundy Editorial2026-06-19T00:00:00.000Zllmcontext-windowraggeminiclaudebenchmarksglm-5-2Groundy Editorialhttps://groundy.com/articles/keep-android-open-f-droid-s-fight-against-locked-down/https://groundy.com/articles/keep-android-open-f-droid-s-fight-against-locked-down/F-Droid, the open-source Android app repository, is leading a global campaign against Google's mandatory developer verification program, a policy set to take effect in September 2026 that critics say will end alternative app distribution and hand Google total control over what software can run on Android devices.Sat, 21 Feb 2026 18:35:38 GMTGroundy Editorial2026-06-20T00:00:00.000Zopen-sourceandroidmobilefreedomGroundy Editorialhttps://groundy.com/articles/claude-code-plugins-anthropic-s-official-plugin-ecosystem/https://groundy.com/articles/claude-code-plugins-anthropic-s-official-plugin-ecosystem/Anthropic's Claude Code plugin directory extends the coding assistant with 55+ official and 72+ community plugins across LSP servers, MCP integrations, and agent orchestration.Sat, 21 Feb 2026 15:51:04 GMTGroundy Editorial2026-06-19T00:00:00.000Zai-toolsanthropicclaudeclaude-codepluginsmcpagentic-codingGroundy Editorialhttps://groundy.com/articles/claude-code-plugins-anthropic-s-official-extension/https://groundy.com/articles/claude-code-plugins-anthropic-s-official-extension/A comprehensive exploration of Anthropic's plugin directory for Claude Code, examining its architecture, capabilities, and impact on AI-assisted software development.Sat, 21 Feb 2026 12:04:35 GMTGroundy Editorial2026-06-26T00:00:00.000Zclaudepluginsai-engineeringclaude-codeanthropicmcpdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/mysterious-chinese-bot-traffic-2026/https://groundy.com/articles/mysterious-chinese-bot-traffic-2026/Chinese bot traffic patterns have shifted dramatically in 2026, with AI-driven bots now accounting for 80% of AI bot activity and record-breaking 31.4 Tbps DDoS attacks. These new behaviors evade traditional detection through residential proxy networks, behavioral mimicry, and sophisticated infrastructure.Fri, 20 Feb 2026 15:39:50 GMTGroundy Editorial2026-06-17T00:00:00.000Zsecuritybotstraffic-analysischinaGroundy Editorialhttps://groundy.com/articles/anthropic-bans-third-party-use-subscription-auth-three-stage-repricing/https://groundy.com/articles/anthropic-bans-third-party-use-subscription-auth-three-stage-repricing/Anthropic's three-stage shift from blocking third-party Claude subscription auth to an API-priced Agent SDK credit pool: what changed, who's affected, what it costs.Fri, 20 Feb 2026 11:13:52 GMTGroundy Editorial2026-06-10T00:00:00.000Zanthropicclaudeapi-policydeveloper-toolsai-codingGroundy Editorialhttps://groundy.com/articles/tailscale-peer-relays-missing-piece-true-p2p/https://groundy.com/articles/tailscale-peer-relays-missing-piece-true-p2p/Tailscale Peer Relays became generally available on February 18, 2026, enabling high-throughput peer-to-peer relaying within your own infrastructure. This feature eliminates the performance bottleneck of DERP servers when NAT traversal fails, delivering true mesh networking even in restrictive network environments.Thu, 19 Feb 2026 19:49:47 GMTGroundy Editorial2026-06-20T00:00:00.000Znetworkingvpninfrastructurep2pGroundy Editorialhttps://groundy.com/articles/letsencrypt-dns-persist-01/https://groundy.com/articles/letsencrypt-dns-persist-01/DNS-Persist-01 proposes persistent DNS TXT records for ACME certificate validation, removing per-renewal DNS updates as certificate lifetimes shrink toward 47 days by 2029.Thu, 19 Feb 2026 18:04:22 GMTGroundy Editorial2026-06-17T00:00:00.000Zweb-platformsecurityinfrastructuressldnsGroundy Editorialhttps://groundy.com/articles/gemini-3-1-pro-google-s-new-reasoning-model/https://groundy.com/articles/gemini-3-1-pro-google-s-new-reasoning-model/Gemini 3.1 Pro is Google's latest reasoning-focused AI model, scoring 77.1% on ARC-AGI-2, more than double its predecessor. Here's how it compares to Claude and GPT.Thu, 19 Feb 2026 15:57:54 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-modelsgooglereasoningbenchmarksgeminifrontier-modelsGroundy Editorialhttps://groundy.com/articles/nautilustrader-building-production-ready-algorithmic/https://groundy.com/articles/nautilustrader-building-production-ready-algorithmic/NautilusTrader pairs Python strategy logic with a Rust-native engine, offering deterministic backtesting, sub-microsecond latency, and live deployment across asset classes.Thu, 19 Feb 2026 14:22:11 GMTGroundy Editorial2026-06-17T00:00:00.000Zfinancetradingrustalgorithmsopen-sourcebacktestingGroundy Editorialhttps://groundy.com/articles/prompt-engineering-patterns-2026-what-actually-works/https://groundy.com/articles/prompt-engineering-patterns-2026-what-actually-works/Prompt engineering in 2026 centers on chain-of-thought reasoning, XML structuring, and model-specific optimization. CoT lifts accuracy up to 61% over zero-shot baselines.Thu, 19 Feb 2026 13:12:24 GMTGroundy Editorial2026-06-27T00:00:00.000Zai-toolspromptsbest-practicestechniquesprompt-engineeringGroundy Editorialhttps://groundy.com/articles/if-you-re-llm-please-read-this-dark-truth-about-ai-training/https://groundy.com/articles/if-you-re-llm-please-read-this-dark-truth-about-ai-training/Anna's Archive addressed AI language models directly: acknowledge shadow library training data and donate. The post exposes the AI industry's debt to pirated archives.Thu, 19 Feb 2026 10:24:57 GMTGroundy Editorial2026-06-24T00:00:00.000Zai-ethicscopyrighttraining-dataopen-accessshadow-librariesfair-useGroundy Editorialhttps://groundy.com/articles/rowboat-open-source-ai-coworker-that-actually/https://groundy.com/articles/rowboat-open-source-ai-coworker-that-actually/Rowboat is an open-source AI coworker with persistent memory that builds a knowledge graph from your work data. Unlike proprietary alternatives, it stores everything locally as plain Markdown, giving you full control over your AI assistant while maintaining long-term context across meetings, emails, and projects.Wed, 18 Feb 2026 19:14:05 GMTGroundy Editorial2026-06-17T00:00:00.000Zai-toolsopen-sourceproductivitymemoryGroundy Editorialhttps://groundy.com/articles/kimi-claw-moonshot-ai-s-answer-claude/https://groundy.com/articles/kimi-claw-moonshot-ai-s-answer-claude/Moonshot AI's Kimi models offer trillion-parameter scale, open weights, and pricing 67x below Claude Fable 5, making it China's leading open-source challenger to Western AI.Wed, 18 Feb 2026 17:00:44 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-modelscompetitionchinachatbotsbenchmarksGroundy Editorialhttps://groundy.com/articles/function-calling-best-practices-llms-that-actually-use-apis/https://groundy.com/articles/function-calling-best-practices-llms-that-actually-use-apis/How to make LLM function calling reliable in production: schema design, structured outputs, error handling, and validation patterns that prevent hallucinated parameters.Wed, 18 Feb 2026 14:17:54 GMTGroundy Editorial2026-06-10T00:00:00.000Zai-engineeringapisbest-practicestoolsclaudeGroundy Editorialhttps://groundy.com/articles/wifi-densepose-full-body-tracking-through-walls-using-your/https://groundy.com/articles/wifi-densepose-full-body-tracking-through-walls-using-your/WiFi routers can perform full-body pose estimation through walls using Channel State Information, turning everyday network infrastructure into a covert tracking system.Wed, 18 Feb 2026 12:20:50 GMTGroundy Editorial2026-05-29T00:00:00.000Zai-researchprivacysurveillancecomputer-visionwifirf-sensingGroundy Editorialhttps://groundy.com/articles/natural-language-sql-ai-finally-making-databases/https://groundy.com/articles/natural-language-sql-ai-finally-making-databases/Text-to-SQL has crossed a practical threshold: SQLCoder-70b hits 96% accuracy on standard benchmarks, outperforming GPT-4 on SQL generation across most query types.Sun, 15 Feb 2026 18:05:07 GMTGroundy Editorial2026-06-24T00:00:00.000Zai-toolsdatabasesnlptext-to-sqlsql-generationdata-accessdeveloper-toolsGroundy Editorialhttps://groundy.com/articles/github-models-free-llm-access-testing/https://groundy.com/articles/github-models-free-llm-access-testing/GitHub Models provided free, rate-limited access to leading AI models within GitHub for prototyping. The platform closed to new customers in June 2026; existing users migrate to Azure AI Foundry or GitHub Copilot's token-metered API.Sun, 15 Feb 2026 15:24:14 GMTGroundy Editorial2026-06-17T00:00:00.000Zai-toolsgithubllmprototypingfree-tierGroundy Editorialhttps://groundy.com/articles/constitutional-ai-teaching-models-self-correct-before-they/https://groundy.com/articles/constitutional-ai-teaching-models-self-correct-before-they/Anthropic's Constitutional AI trains models to critique and revise their own outputs against written principles instead of human labels, with mixed evidence on safety.Sun, 15 Feb 2026 13:52:08 GMTGroundy Editorial2026-06-26T00:00:00.000Zai-ethicssafetyanthropicalignmentrlhfclaudeGroundy Editorialhttps://groundy.com/articles/ai-code-generation-benchmarks-2026-which-model-actually/https://groundy.com/articles/ai-code-generation-benchmarks-2026-which-model-actually/Frontier and open-weight coding models now post similar benchmark scores, but real-world software engineering exposes gaps between leaderboard results and practical utility.Sun, 15 Feb 2026 11:01:06 GMTGroundy Editorial2026-06-19T00:00:00.000Zai-researchbenchmarkscode-generationcomparisonllmopen-sourceGroundy Editorialhttps://groundy.com/articles/tree-sitter-code-indexing-the-secret-to-better-ai-code-understanding/https://groundy.com/articles/tree-sitter-code-indexing-the-secret-to-better-ai-code-understanding/How tree-sitter-backed semantic parsing transforms LLM code comprehension, powering the next generation of AI coding assistants with precise, incremental code analysis.Sat, 14 Feb 2026 18:10:53 GMTGroundy EditorialGroundy Editorialhttps://groundy.com/articles/claude-code-fast-mode-6x-pricing-worth/https://groundy.com/articles/claude-code-fast-mode-6x-pricing-worth/Fast mode delivers 2.5x faster Claude Opus responses at 6x the cost. We break down the economics after the Opus 4.7 default swap and when the premium pays off.Sat, 14 Feb 2026 14:37:51 GMTGroundy Editorial2026-06-28T00:00:00.000Zclaudepricingoptimizationbenchmarksdeveloper-toolsai-toolsGroundy Editorialhttps://groundy.com/articles/the-complete-guide-to-local-llms/https://groundy.com/articles/the-complete-guide-to-local-llms/Why running AI on your own hardware is becoming the default choice for privacy-conscious developers and enterprises that need data sovereignty, cost control, and low latency.Thu, 12 Feb 2026 18:57:59 GMTGroundy Editorial2026-06-08T00:00:00.000Zlocal-aiollamallamacppvllmprivacyself-hosted-aiGroundy Editorialhttps://groundy.com/articles/data-is-your-prd-andrew-ng-framework/https://groundy.com/articles/data-is-your-prd-andrew-ng-framework/How AI product managers are rewriting the rules with data-driven requirements that replace traditional specification documentsThu, 12 Feb 2026 17:32:11 GMTGroundy Editorialai-product-managementandrew-ngprddata-driven-developmentmachine-learningGroundy Editorialhttps://groundy.com/articles/crewai-vs-autogen-developers-guide/https://groundy.com/articles/crewai-vs-autogen-developers-guide/Comparing CrewAI and Microsoft's AutoGen for multi-agent AI: architecture, code examples, ergonomics, and which framework fits production deployments in 2026.Thu, 12 Feb 2026 14:41:18 GMTGroundy Editorial2026-06-19T00:00:00.000Zaimulti-agentcrewaiautogenpythonagent-orchestrationGroundy Editorialhttps://groundy.com/articles/are-ai-generated-prs-killing-open-source/https://groundy.com/articles/are-ai-generated-prs-killing-open-source/How open source projects can use AI contributions without drowning in low-quality noise, through the lens of Mitchell Hashimoto's Vouch system and the maintainer crisis.Thu, 12 Feb 2026 11:51:55 GMTGroundy Editorial2026-06-20T00:00:00.000Zaiopen-sourcegithubpull-requestsmitchell-hashimotovouchGroundy Editorialhttps://groundy.com/articles/pydantic-ai-vs-langchain/https://groundy.com/articles/pydantic-ai-vs-langchain/A practical comparison of Pydantic AI and LangChain on type safety, developer experience, and production readiness for Python AI agent frameworks.Wed, 11 Feb 2026 17:53:59 GMTGroundy Editorial2026-06-19T00:00:00.000Zpydantic-ailangchainai-agentspythonagent-frameworkstype-safetydeveloper-experienceGroundy Editorialhttps://groundy.com/articles/openhands-autonomous-coding/https://groundy.com/articles/openhands-autonomous-coding/Build autonomous coding agents with the OpenHands SDK: architecture, deployment modes, benchmark standing, and where it fits the 2026 agentic-coding field.Wed, 11 Feb 2026 16:07:05 GMTGroundy Editorial2026-06-26T00:00:00.000Zopenhandsaicoding-agentssdkautomationmachine-learningsoftware-engineeringGroundy Editorialhttps://groundy.com/articles/best-ai-models-openclaw-2026/https://groundy.com/articles/best-ai-models-openclaw-2026/Which LLM to pick for OpenClaw in 2026: Fable 5, Opus 4.8, GLM-5.2, Kimi K2.5, and Gemini 3.1 Pro ranked by use case, benchmark evidence, and pricing.Wed, 11 Feb 2026 12:09:51 GMTGroundy Editorial2026-06-19T00:00:00.000Zopenclawllmai-modelscodingclaudeglmgeminiGroundy Editorial